DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment S-Lap8 and Npepl1

DIOPT Version :9

Sequence 1:NP_611132.1 Gene:S-Lap8 / 36844 FlyBaseID:FBgn0034132 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001365722.1 Gene:Npepl1 / 228961 MGIID:2448523 Length:529 Species:Mus musculus


Alignment Length:446 Identity:112/446 - (25%)
Similarity:179/446 - (40%) Gaps:65/446 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GRLYQNIDKEYWAVA--------------------VVGLGKEGAGFNAEEVIDEGMENVRVCAAV 142
            |:|...:.:|.|..|                    |..|....:..|:..........||.|...
Mouse    41 GKLQPRVTEELWQAALATLNPNPTDSCPLYLNCATVAALPSRVSRHNSPSAAHFITRLVRTCLPP 105

  Fly   143 GAR--ALQLQGCTTCHVDGMEYPEQAAEGAAMA------VWRYNVNKRKKNRIAIPKLELYGSTD 199
            |..  .|...|...|     |..|..|...|:|      ..|...::|.:.|..:.:..|.|..:
Mouse   106 GTHRCILVSAGPMVC-----EQTEVFASACALARAFPLFTHRSGASRRAEKRTVMVEFFLVGQDN 165

  Fly   200 ---QDAWTRGLFKA-ESQNLARRLSDTPANQMTPSIFAQATVDALCPCGVSVEVRSMDWIETQNL 260
               :.:..:.|..| |...||.|:.|||.|:|...||.:..:......|::..:...:.::|:..
Mouse   166 GPVEVSTLQCLTNATEGVRLAARIVDTPCNEMNTDIFLEEIIQVGKELGITPTIIRDEQLKTKGF 230

  Fly   261 NSFLMVAKGSCEPPIILEVSYCGTSPE--ERPILMLGKGLTFNSGGLCLHPKRGMDEYRGAVSGA 323
            .....|.|.:..||.:..:|:   :|:  .:.|..:|||:.:::|||.:..|..|...:....||
Mouse   231 GGIYGVGKAALHPPALAILSH---TPDGATQTIAWVGKGIVYDTGGLSIKGKTTMPGMKRDCGGA 292

  Fly   324 AVCVAAIRAAAALSLPINVSAVLPLCENMPSGMATKPGDVVTLLNGKTMRIKDISLAGTVLLADP 388
            |..:.|.|||.......|:.||..|.||.....||:|.|:..|.:|||:.|.:....|.::|||.
Mouse   293 AAVLGAFRAAIKQGFKDNLHAVFCLAENAVGPNATRPDDIHLLYSGKTVEINNTDAEGRLVLADG 357

  Fly   389 LLYAQSTFKPKLVVEVGSM--ASGIRKGLGASATGLWTNNSFLWK-NFQKAGALTGDRLWRMPL- 449
            :.||.......::|::.::  |.||..|...:|.   ..||..|: ...|||...||.:  .|| 
Mouse   358 VSYACKDLGADIIVDMATLTGAQGIATGKYHAAV---LTNSAEWEAACVKAGRKCGDLV--HPLV 417

  Fly   450 ------WRYFRKLVAPRASYDICSTGEGHASSC----LAAAILYELVPCSDWVHLD 495
                  :..|...||...  :..:..:...|||    :|:.|.::..  ..|||||
Mouse   418 YCPELHFSEFTSAVADMK--NSVADRDNSPSSCAGLFIASHIGFDWP--GVWVHLD 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
S-Lap8NP_611132.1 Peptidase_M17 51..528 CDD:238247 112/446 (25%)
PepB 66..532 CDD:223338 112/446 (25%)
Npepl1NP_001365722.1 Peptidase_M17 35..492 CDD:238247 112/446 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0260
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1683
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.