DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15712 and CG14963

DIOPT Version :9

Sequence 1:NP_611131.2 Gene:CG15712 / 36843 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_647778.1 Gene:CG14963 / 38383 FlyBaseID:FBgn0035409 Length:261 Species:Drosophila melanogaster


Alignment Length:199 Identity:35/199 - (17%)
Similarity:79/199 - (39%) Gaps:35/199 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LREDLKDFVALVPRRRIGFIAARYYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFVNIINYVSD 90
            |.:||::...|:..:.:..:..||.|.|.:|:..|..:.|:..:....::.:.|:.:..:.:...
  Fly    47 LSQDLEEIQRLIQSKPLNQLLVRYLINDAQFQAFVRIINSNAAVTARWRLLSQPELILFLQWTDQ 111

  Fly    91 Y----GSGYDI------TTLVDSLPTRLRAYQLSRTVPVELMLRRDLNTFLW-----DVIHSLPR 140
            .    |..:::      .:|::..|      ..|.||            |.|     :|....|.
  Fly   112 QLLASGGSFELEEQRLKVSLLNQFP------YWSGTV------------FGWQGFLNEVQLYFPL 158

  Fly   141 TRIYSLIAQKSKQSTEFAKLYKALRDKEFKELVQRARLSRDLQAPIKKLSQKSINVDEILQIVFE 205
            ..|.:.|..|..|...||:.:..|:.  .:.:.:|...:.:....:.:|.:..|:..::..|:.|
  Fly   159 YAIRAHIDAKVLQQGIFAQFWSRLQG--LRVMYERWLTTVETTQVLAELQKAGIDTVQLDGIIRE 221

  Fly   206 VISW 209
            ::.|
  Fly   222 LLGW 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 32/188 (17%)
CG14963NP_647778.1 Ins_allergen_rp 49..216 CDD:284230 31/186 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462475
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.