DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15712 and CG3906

DIOPT Version :9

Sequence 1:NP_611131.2 Gene:CG15712 / 36843 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_611802.1 Gene:CG3906 / 37721 FlyBaseID:FBgn0034871 Length:240 Species:Drosophila melanogaster


Alignment Length:167 Identity:40/167 - (23%)
Similarity:79/167 - (47%) Gaps:13/167 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFVNIINYV-SDYGSGYDITTLVD-----SLPTR 107
            :|..|.|||:|:.:..:..|..|.||:..|..:..::..: |:.....||.|:.|     .||.|
  Fly    81 HYNCDLKFRRAMRYYNTAGFERTTQQLTDTDAYKTVLKELQSESVDTADIETVADIFHCIILPVR 145

  Fly   108 LRAYQLSRTVPVELMLRRDLNTFLWDVIHSLPRTRIYSLIAQKSKQSTEFAKLYKALRDKEFKEL 172
                |..|....:.:..   :||:.|::..:|:..:::.:||.....|.|....||:..|:|:..
  Fly   146 ----QPDRNCDCKAVKH---HTFVGDLLSIMPKQEVHNYVAQSQANHTNFGNFTKAVVSKQFQAT 203

  Fly   173 VQRARLSRDLQAPIKKLSQKSINVDEILQIVFEVISW 209
            ::.....||:..|::.|.:...::.|:|:.:..:..|
  Fly   204 LKANINKRDVVKPLRTLRKNGWDIPELLRAMLTIFQW 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 38/156 (24%)
CG3906NP_611802.1 Ins_allergen_rp 57..231 CDD:284230 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462461
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.