DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15712 and CG4409

DIOPT Version :9

Sequence 1:NP_611131.2 Gene:CG15712 / 36843 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001097337.1 Gene:CG4409 / 36840 FlyBaseID:FBgn0034128 Length:276 Species:Drosophila melanogaster


Alignment Length:194 Identity:45/194 - (23%)
Similarity:93/194 - (47%) Gaps:16/194 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLKDFVALVPRRRIGFIAARYYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFVNIINYVSDYGS 93
            ||..||||:|.:.:..|||.||..|.:|:::..|:.|.:|....:::...|:.:...||:.:  :
  Fly    81 DLSAFVALIPLQEVQSIAAHYYHHDAEFQRSYAFLASSDFADIKRKILQLPEVLEFTNYLGN--N 143

  Fly    94 GYDITTLVDSLPTRLRAYQLSRTV---PVELMLRRD-----------LNTFLWDVIHSLPRTRIY 144
            |.|:..::.|:....:...||...   |.::....|           |:..:..|:..||:.::|
  Fly   144 GLDVVKVMHSVAGVFKPSILSSAAVNEPTKVTTTEDGSSAAGEAQTGLHGMVERVLEILPQDQLY 208

  Fly   145 SLIAQKSKQSTEFAKLYKALRDKEFKELVQRARLSRDLQAPIKKLSQKSINVDEILQIVFEVIS 208
            :|...:.:.:.:||....::...:|.:::...:.|..|:..:..|...||.|:.|::.|...:|
  Fly   209 ALFFDEFESNKQFAAFVDSISSPKFAKILSGLQNSMPLRNLLFVLHNNSIYVERIVESVKSYLS 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 42/184 (23%)
CG4409NP_001097337.1 Ins_allergen_rp 81..264 CDD:284230 42/184 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462481
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C6BV
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.