DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15712 and jtb

DIOPT Version :9

Sequence 1:NP_611131.2 Gene:CG15712 / 36843 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_611126.1 Gene:jtb / 36838 FlyBaseID:FBgn0034126 Length:233 Species:Drosophila melanogaster


Alignment Length:201 Identity:65/201 - (32%)
Similarity:110/201 - (54%) Gaps:21/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DLKDFVALVPRRRIGFIAARYYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFVNIINYVSDYGS 93
            :||||..|:|...|..:.|.:.|.|..||:|::|:||.:|....|::.:.|:.|::||:|.    
  Fly    37 ELKDFEKLIPTVTIDEVVAEHMITDSGFRKAIKFLRSSDFKTLQQRIESLPEVVDLINFVH---- 97

  Fly    94 GYDITT--------LVDSLPTRLR--AYQLSRTVPV------ELMLRRDLNTFLWDVIHSLPRTR 142
             .:.||        ..::...|||  ||...:.|.|      |........:|:.:::..|||.|
  Fly    98 -LNDTTQETVEKYWYRNNTYNRLRRSAYLREQIVLVLLESSSEFTQLSSFTSFVREILTHLPRDR 161

  Fly   143 IYSLIAQKSKQSTEFAKLYKALRDKEFKELVQRARLSRDLQAPIKKLSQKSINVDEILQIVFEVI 207
            ..:||.:|.::|..|||.|:||:..|||...:.|..:.::|:.:::||:.:|:..::..|.:|||
  Fly   162 FVALINEKRQKSALFAKFYQALKSAEFKAKSEAAWKTSNVQSVVQELSRHAIDAQDLKTIGYEVI 226

  Fly   208 SWGPKT 213
            ||||.|
  Fly   227 SWGPNT 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 56/186 (30%)
jtbNP_611126.1 Ins_allergen_rp 33..219 CDD:284230 56/186 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462463
Domainoid 1 1.000 69 1.000 Domainoid score I16611
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I7459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0019669
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.