DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15712 and CG9021

DIOPT Version :9

Sequence 1:NP_611131.2 Gene:CG15712 / 36843 FlyBaseID:FBgn0034131 Length:214 Species:Drosophila melanogaster
Sequence 2:NP_001285647.1 Gene:CG9021 / 33818 FlyBaseID:FBgn0031747 Length:316 Species:Drosophila melanogaster


Alignment Length:200 Identity:43/200 - (21%)
Similarity:88/200 - (44%) Gaps:18/200 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 CWATAFGGLREDLKDFVALVPRRRIGFIAARYYIFDPKFRQAVEFVRSDEFIATWQQVRATPDFV 82
            |...|..||...::....|:|...:..|.|. .:.||:.::.::.:|||.|....|.::||....
  Fly   113 CPTNAERGLTNLVRVARPLLPAATLKNILAN-GVEDPQVQELIKLLRSDNFKTQVQLLKATKQHQ 176

  Fly    83 NIINYV-------SDYGSGYDITTLVDSLPTRLRAYQLSRTVPVELMLRR-DLNTFLWDVIHSLP 139
            .:.:||       ..|.:.| :...:|        ..:|....::|..|| .:...|.|:..:||
  Fly   177 LLHDYVCRRLKLDPTYYAEY-VRVFLD--------LHISDPPTIKLPNRRPGVRGLLQDLREALP 232

  Fly   140 RTRIYSLIAQKSKQSTEFAKLYKALRDKEFKELVQRARLSRDLQAPIKKLSQKSINVDEILQIVF 204
            ||.:.::..|.....:|.:...:.:|..||:.|::..|..::.::....|.:..:.:.::.|:|.
  Fly   233 RTALRNMYQQLYSSDSELSSAIRLIRGSEFRRLLRDLRQLKEYRSLAADLEKSGVPLRQLQQLVA 297

  Fly   205 EVISW 209
            ..:.|
  Fly   298 NALGW 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15712NP_611131.2 Ins_allergen_rp 25..200 CDD:284230 38/182 (21%)
CG9021NP_001285647.1 Ins_allergen_rp 120..293 CDD:284230 38/182 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21163
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.