DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Parp16 and Parp6

DIOPT Version :9

Sequence 1:NP_725583.1 Gene:Parp16 / 36841 FlyBaseID:FBgn0034129 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_006511438.1 Gene:Parp6 / 67287 MGIID:1914537 Length:642 Species:Mus musculus


Alignment Length:265 Identity:57/265 - (21%)
Similarity:89/265 - (33%) Gaps:76/265 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 AAAWSYRYRTRLRPFPSHWNTID---LVFNTLGDAPR---LEVLQQQLMHCDYQACSPNVVRLLT 129
            ||..|.|......|:||..:..|   |.||     |:   .|.||:.|       .|...:|.:|
Mouse   344 AALESPRKSIIFEPYPSVVDPTDPKTLAFN-----PKKKNYERLQKAL-------DSVMSIREMT 396

  Fly   130 D----ILVDQADRVS----------LSSLR------PCEFQELYAH-----LGMSPPKQPPTQIF 169
            .    .:..|.|::.          :||.|      |...|..:.|     |.:|   .||.:..
Mouse   397 QGSYLEIKKQMDKLDPLAHPLLQWIISSNRSHIVKLPLSRQLKFMHTSHQFLLLS---SPPAKEA 458

  Fly   170 EVRTGKGNEKGEAYASLRQENKESVRLGFYGCKLEKVYALLNSQNSLDNGKYLELTCDINEALAR 234
            ..||.|     :.|.|         ...|:|..:|..:::|  :|.|.|..|.:|...|...:..
Mouse   459 RFRTAK-----KLYGS---------TFAFHGSHIENWHSIL--RNGLVNASYTKLQAHIFILVFP 507

  Fly   235 SKPQAGVGGSRCGSILRCVAVVEFVF------------QDNETSRDKKQVIIKDANTMQVSYLLL 287
            .|......|.  |..|..::.:.|.:            :|....|..:...|....::|..:|..
Mouse   508 CKLHGAAYGK--GIYLSPISSISFGYSGMGKGQHRMPSKDELVQRYNRMNTIPQTRSIQSRFLQS 570

  Fly   288 YGQSC 292
            ...:|
Mouse   571 RNLNC 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Parp16NP_725583.1 ARTD15_N 53..132 CDD:375539 19/70 (27%)
Parp6XP_006511438.1 ADP_ribosyl 222..358 CDD:238651 4/13 (31%)
ADP_ribosyl 471..606 CDD:238651 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21328
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.