DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Parp16 and CG15337

DIOPT Version :9

Sequence 1:NP_725583.1 Gene:Parp16 / 36841 FlyBaseID:FBgn0034129 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_572455.1 Gene:CG15337 / 31748 FlyBaseID:FBgn0030014 Length:405 Species:Drosophila melanogaster


Alignment Length:358 Identity:66/358 - (18%)
Similarity:121/358 - (33%) Gaps:104/358 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VALLPNSIG----------------LSLKPVTPH----------------------------LRD 47
            :.::|||:.                ..|:|..||                            :||
  Fly     7 MGMVPNSLNPILNPRPLPIPVTKPRTKLQPDEPHDGVLAFNKGKVPPPVSSRPIPLQRAMSEVRD 71

  Fly    48 LHLVQRRLQDDFLGCEALWTIFMAAAWSYRYRTRLRPFPSHWNT-------IDLVFNTLGDA-PR 104
            ....|.:..|..|      .||.|||.|..:...|.|.|..:..       :|.:.:.:.|. |.
  Fly    72 ALRAQPQASDIRL------LIFTAAASSVEHERTLIPVPPQFQAAPGSGCQVDRLRHAVADNWPS 130

  Fly   105 LEVLQQQLMHC-----DYQACSP---NVVRLLTDILVDQADRVSLSSLRPCEFQELYAHLGMSPP 161
            ..:    ::.|     .|.|..|   :.:.||..|||......:|..:.....:.|...||::.|
  Fly   131 CRI----MLDCPSTDEQYAALMPDDVDALHLLHWILVATPSSPTLRRMSGLHLRRLCRFLGLARP 191

  Fly   162 KQPPTQIFEV-------RTGKGNEK---GEAYASL------------RQENKESVRLGFYGCKLE 204
            ...|..:..:       |.|..:.:   ..||..|            |.|....|.:..| .:.|
  Fly   192 TLEPGHLLSISYERNVQRLGDSSPRPRSSYAYLGLPFQYLYRFLATGRLEQPPGVAIRLY-AQPE 255

  Fly   205 KVYALLNSQNSLDNGKYLELTCDINEALARSKPQAGVGGSRC--GSIL----RCVAVVEFVFQDN 263
            ......:..:||...::::.....:......:.|:|...|.|  .|.|    |.:.:.|...:.:
  Fly   256 TALVHCDELSSLPQQQHVQSEEQSSSQSIAEREQSGNSSSLCWRNSTLTAPQRALVICELPSELD 320

  Fly   264 ET---SRDKK--QVIIKDANTMQVSYLLLYGQS 291
            |:   |.:|.  :..::::.:::..||||:.::
  Fly   321 ESIAHSPEKHFLEYFVQESLSLRPCYLLLFDEA 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Parp16NP_725583.1 ARTD15_N 53..132 CDD:375539 20/94 (21%)
CG15337NP_572455.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.