DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15710 and CG18764

DIOPT Version :10

Sequence 1:NP_611122.1 Gene:CG15710 / 36832 FlyBaseID:FBgn0034120 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:180 Identity:42/180 - (23%)
Similarity:64/180 - (35%) Gaps:58/180 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 QRRLARMMKDVPDVSQHQCNICKKIFSSVDALIGHRLLHGSPSMNRTCASCHVKFGTDLEYRTHL 140
            ::||.|..:.|       |..|.:.|:.......|.|.| :.:.|..|..|..:|.||  :...|
  Fly   249 RKRLQRKRECV-------CEQCGRQFTDQSNFKLHMLRH-TGNKNFACQQCGKRFYTD--HLMTL 303

  Fly   141 ESHLIPCESTDESYEGAYTITKTFNCVFC--------------RTEFKACFKPGQVTRRYACDAC 191
            ...:|        ::|    .|.::|.||              ||...|  ||...   :.||.|
  Fly   304 HQRII--------HQG----EKPYDCRFCTKSFHNSNTRLIHERTHTNA--KPYSC---HHCDKC 351

  Fly   192 IVRLKAQEEEKKILGKRRPELI--------CDRCGKKYKYEGFLHRHLKT 233
            .         |...|::|.|||        |..|.:.::....|..||::
  Fly   352 F---------KSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLRS 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15710NP_611122.1 None
CG18764NP_652712.2 zf-AD 4..75 CDD:214871
C2H2 Zn finger 260..280 CDD:275368 5/19 (26%)
zf-H2C2_2 272..297 CDD:463886 7/25 (28%)
C2H2 Zn finger 288..309 CDD:275368 7/30 (23%)
C2H2 Zn finger 317..337 CDD:275368 4/19 (21%)
zf-H2C2_2 333..354 CDD:463886 8/34 (24%)
C2H2 Zn finger 345..365 CDD:275368 8/31 (26%)
C2H2 Zn finger 373..391 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.