| Sequence 1: | NP_611122.1 | Gene: | CG15710 / 36832 | FlyBaseID: | FBgn0034120 | Length: | 265 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_061277.2 | Gene: | Plagl2 / 54711 | MGIID: | 1933165 | Length: | 496 | Species: | Mus musculus |
| Alignment Length: | 202 | Identity: | 46/202 - (22%) |
|---|---|---|---|
| Similarity: | 78/202 - (38%) | Gaps: | 26/202 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 53 FHCPL--CSNVIRTAGAYKVHLMACQRRLARMMKDVPDVSQHQCNICKKIFSSVDALIGHRLLHG 115
Fly 116 SPSMNRTCASCHVKFGTDLEYRTHLESHL-----IPCESTDESYEGAYTITKTFNCVFCRTEFKA 175
Fly 176 CFKPGQVTRRYACDACIVRLKAQEEEKK--ILGKRRPELICDRCGKKYKYEGFLHRHLKTCQMPD 238
Fly 239 KCKRKRE 245 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG15710 | NP_611122.1 | None | |||
| Plagl2 | NP_061277.2 | C2H2 Zn finger | 42..62 | CDD:275368 | |
| C2H2 Zn finger | 70..92 | CDD:275368 | 8/28 (29%) | ||
| zf-H2C2_2 | 85..109 | CDD:372612 | 9/32 (28%) | ||
| C2H2 Zn finger | 100..120 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 129..149 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 158..178 | CDD:275368 | 2/19 (11%) | ||
| C2H2 Zn finger | 193..213 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 221..239 | CDD:275368 | 5/17 (29%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||