DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15710 and CG6813

DIOPT Version :10

Sequence 1:NP_611122.1 Gene:CG15710 / 36832 FlyBaseID:FBgn0034120 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001163590.1 Gene:CG6813 / 41396 FlyBaseID:FBgn0037923 Length:294 Species:Drosophila melanogaster


Alignment Length:161 Identity:40/161 - (24%)
Similarity:59/161 - (36%) Gaps:26/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SEELEPATLLSIQEDNGIVTKVYVAPCLQPIKEEKVFLEDNTQR------FHCPL--CSNVIRTA 65
            :|::...|.|:.|:..|..|..||.|....|...|...:::|.|      |||..  |.....|.
  Fly   120 AEKVSAPTSLNHQKSIGGGTGPYVCPDCGRIINNKSNFQEHTLRHTGIKNFHCVFLNCERSFATR 184

  Fly    66 GAYKVH-----------LMACQRRLARMMKDVPDVSQH------QCNICKKIFSSVDALIGHRLL 113
            .....|           .:.|.||.:..........:|      :|:.|||.|.|...|..|:::
  Fly   185 KELTSHTRIHTGEQPYVCVYCPRRFSSSGARQEHHRRHRNERRYECDTCKKSFVSSGCLRKHKMI 249

  Fly   114 HGSPSMNRTCASCHVKFGTDLEYRTHLESHL 144
            | ..:.|..|..|...|.......|||.|::
  Fly   250 H-VDARNHYCYVCQKHFKRISHLMTHLSSNI 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15710NP_611122.1 None
CG6813NP_001163590.1 zf-AD 5..76 CDD:462262
C2H2 Zn finger 144..164 CDD:275368 4/19 (21%)
C2H2 Zn finger 172..194 CDD:275368 4/21 (19%)
UFD2 <256..>294 CDD:227443 7/24 (29%)
C2H2 Zn finger 258..280 CDD:275368 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.