DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15710 and nom

DIOPT Version :10

Sequence 1:NP_611122.1 Gene:CG15710 / 36832 FlyBaseID:FBgn0034120 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649821.2 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:193 Identity:49/193 - (25%)
Similarity:69/193 - (35%) Gaps:60/193 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DVPDVSQHQCNICKKIFSSVDALIGHRLLHGS----PSMNRTCASCHVKFGTDLEYRTHLESH-- 143
            |:|:|..|:|:.|..|.::..:|:.|:..|..    |     |..|...|....|.:.|..:|  
  Fly   175 DLPNVQIHKCDTCGIIKNNKSSLVRHQFEHNGIRPYP-----CKECPKTFLVASELKAHNLTHHT 234

  Fly   144 LIP---CESTDESY---------EGAYTITKTFNCVFCRTEF------KACFKPGQVTRRYACDA 190
            |.|   |...|..|         |..:|..:.|.|..|...|      ||.....||.|:|:|| 
  Fly   235 LEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCD- 298

  Fly   191 CIVRLKAQEEEKKILGKRRPELICDRCGKKYKYEGFLHRHLKTCQMPDKCKRKREIEITEVSE 253
                                  :|||...       |.:||.|..:.:..||..| .:|..||
  Fly   299 ----------------------VCDRSFS-------LKKHLATHFISNTHKRNAE-AVTSSSE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15710NP_611122.1 None
nomNP_649821.2 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 5/19 (26%)
C2H2 Zn finger 212..261 CDD:275368 12/48 (25%)
C2H2 Zn finger 269..289 CDD:275368 5/19 (26%)
C2H2 Zn finger 297..313 CDD:275368 8/45 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.