DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15710 and CG3847

DIOPT Version :9

Sequence 1:NP_611122.1 Gene:CG15710 / 36832 FlyBaseID:FBgn0034120 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_572317.2 Gene:CG3847 / 31577 FlyBaseID:FBgn0029867 Length:380 Species:Drosophila melanogaster


Alignment Length:267 Identity:84/267 - (31%)
Similarity:129/267 - (48%) Gaps:47/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EELEPATLLSIQEDNGIVTKVYVAPCLQPIKEEKV--FLEDNT------------QRFHCPLCSN 60
            ||||...  .::.|:..||..:....|: :::::|  .:.::|            :.|:||.|.|
  Fly   132 EELEDGE--EVEHDDEFVTVDHEGGELE-VEDDEVGSIVFESTIDHAEQDPYGRNKTFYCPNCGN 193

  Fly    61 VIRTAGAYKVHLMACQRRLARMMKDVPDVSQHQCNICKKIFSSVDALIGHRLLHGSPSMNRTCAS 125
            ....||:.|:|:.||.|:...:..|     :.:|.:|.|:|:||..|..|.:.|......| |..
  Fly   194 CYSAAGSLKLHMRACLRQRNEISTD-----ERKCKVCSKVFNSVAYLKEHMMRHTGEQPFR-CTR 252

  Fly   126 CHVKFGTDLEYRTHLESHLIPCESTDES------YEGAYTITKTFNCVFCRTEFKACFKPGQVTR 184
            |:.||..:.::..|:|||....:...|:      :.|...:.|.|.|.||...|...|..|||.|
  Fly   253 CYRKFVEESKFTAHMESHKHQDKLEAEAVALAAQHGGKKVVVKEFQCAFCSQNFTVVFDVGQVKR 317

  Fly   185 RYACDAC---------IVRLKAQEEEKKILGKRRPELICDRCGKKYKYEGFLHRHLKTCQMPDKC 240
            |||||||         :.:.|.|.|||:       |..|.|||:|:.:||||.|||.||.  ...
  Fly   318 RYACDACRDKYSNAEALRQHKQQVEEKR-------EFSCVRCGRKFVFEGFLQRHLPTCD--GSI 373

  Fly   241 KRKREIE 247
            ||:|:::
  Fly   374 KRRRDMK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15710NP_611122.1 None
CG3847NP_572317.2 C2H2 Zn finger 188..216 CDD:275368 11/27 (41%)
C2H2 Zn finger 222..242 CDD:275368 8/19 (42%)
C2H2 Zn finger 250..270 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442367
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3C8ND
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.