DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment wcd and Poc1b

DIOPT Version :9

Sequence 1:NP_611121.1 Gene:wcd / 36831 FlyBaseID:FBgn0262560 Length:506 Species:Drosophila melanogaster
Sequence 2:XP_002729827.2 Gene:Poc1b / 100362836 RGDID:2323942 Length:477 Species:Rattus norvegicus


Alignment Length:220 Identity:49/220 - (22%)
Similarity:83/220 - (37%) Gaps:51/220 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 TSIQFHPTSTAALVAGMNGLATIYAVD--GQKNERLHNMRFKKFPLACSRIAPCGTRAFFGSVKP 271
            ||:||.|.......|..:....::.:|  |:.:|      ||      :..||         |:.
  Rat    64 TSLQFSPQGNLLASASRDKTVRLWVLDRKGKSSE------FK------AHTAP---------VRS 107

  Fly   272 FYYSYD---LLEAKESKLKLPGAMEFMHRF--------------EVSPCGKFIVTAGKFGAIHLL 319
            ..:|.|   |:.|.|.|.....:| :..||              :.||.|:.||:..:...|.:.
  Rat   108 VDFSADGQFLVTASEDKSIKVWSM-YRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIW 171

  Fly   320 TAKTNELLHSFKQEGKVKGFT-WSSDSKRILVCGSTSNVSVLNLRQN-LIEHIFMDDGCIHG--- 379
            ...:.:.:::|........|. :|.:...|...||...|.:.::|.| |::|.     .:|.   
  Rat   172 DTTSKQCVNNFSDSVGFANFVDFSPNGTCIASAGSDHAVRIWDIRMNRLLQHY-----QVHSCGV 231

  Fly   380 ESIQLSPNQRLLATGSQEGVVNIYD 404
            ..:...|:...|.|.|.:|.|.|.|
  Rat   232 NCLSFHPSGNSLVTASSDGTVKILD 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
wcdNP_611121.1 WD40 <131..444 CDD:225201 49/220 (22%)
WD40 repeat 209..247 CDD:293791 9/39 (23%)
WD40 296..>504 CDD:295369 28/128 (22%)
WD40 repeat 298..332 CDD:293791 8/47 (17%)
WD40 repeat 337..371 CDD:293791 10/35 (29%)
WD40 repeat 376..415 CDD:293791 9/32 (28%)
WD40 repeat 428..465 CDD:293791
Poc1bXP_002729827.2 WD40 10..298 CDD:238121 49/220 (22%)
WD40 14..>300 CDD:225201 49/220 (22%)
WD40 repeat 21..58 CDD:293791
WD40 repeat 64..100 CDD:293791 11/47 (23%)
WD40 repeat 105..141 CDD:293791 10/36 (28%)
WD40 repeat 148..183 CDD:293791 6/34 (18%)
WD40 repeat 189..225 CDD:293791 10/40 (25%)
WD40 repeat 231..267 CDD:293791 8/26 (31%)
WD40 repeat 273..297 CDD:293791
Ribosomal_S10 <331..365 CDD:294222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.