DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup62 and NUP116

DIOPT Version :9

Sequence 1:NP_001286489.1 Gene:Nup62 / 36830 FlyBaseID:FBgn0034118 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_013762.1 Gene:NUP116 / 855066 SGDID:S000004650 Length:1113 Species:Saccharomyces cerevisiae


Alignment Length:407 Identity:99/407 - (24%)
Similarity:149/407 - (36%) Gaps:98/407 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GAATTAPATKTTFSFGTPAPTAGIGG-------GDADNSKAQAPPAFGFGLG---SGTASAPLTL 90
            ||..|.....:.||..|...:.||.|       |....:|.|  ||.|...|   |.|....|..
Yeast   526 GAKPTGFGNTSLFSNSTTNQSNGISGNNLQQQSGGLFQNKQQ--PASGGLFGSKPSNTVGGGLFG 588

  Fly    91 GTQAA--ANPASTTSATATGTSAAPPAFGG--FTAQPAASVVPTIATSAPNTAATT--TGLLGGS 149
            ..|.|  .|||||:........|....|||  .||..|:|.....:.:|.||||||  |||.|..
Yeast   589 NNQVANQNNPASTSGGLFGSKPATGSLFGGTNSTAPNASSGGIFGSNNASNTAATTNSTGLFGNK 653

  Fly   150 GLGAPKTTAAASTTLTAAPSAIASTQGAA-------PAPTLSTGGAFANLTTETKTTDSSAVSTA 207
            .:||..:|:|.........|::.::.|:.       .:.:.:.||.|.| .|.|.|:.....|..
Yeast   654 PVGAGASTSAGGLFGNNNNSSLNNSNGSTGLFGSNNTSQSTNAGGLFQN-NTSTNTSGGGLFSQP 717

  Fly   208 SQ---LSYHQLEEHINKWTLEFEEQEKVFTEQ------------------ATQINAWD--KLLIS 249
            ||   .|.:.|::...:..|:.:......|.:                  ||:|.|.:  |..::
Yeast   718 SQSMAQSQNALQQQQQQQRLQIQNNNPYGTNELFSKATVTNTVSYPIQPSATKIKADERKKASLT 782

  Fly   250 NNGKIVELNDAVKKVKTDQQVLDQELEFIATQQKELEDSLGPLEKEFVNLPRVDMERSQTYLMV- 313
            |..|::.......|:||:..|:|:       .|.:::..|.           :.:::....:.: 
Yeast   783 NAYKMIPKTLFTAKLKTNNSVMDK-------AQIKVDPKLS-----------ISIDKKNNQIAIS 829

  Fly   314 ----ENLDTQLKQMSE--------DLKEIIDN------LNEANKGQDTTDPIIQIGKILNAHMNS 360
                ||||..:.:.||        ..|.:|:|      ..|.|.|....|            ||.
Yeast   830 NQQEENLDESILKASELLFNPDKRSFKNLINNRKMLIASEEKNNGSQNND------------MNF 882

  Fly   361 LQWIESQSTNISKKLED 377
            ....|.|.|.:.|...|
Yeast   883 KSKSEEQETILGKPKMD 899

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup62NP_001286489.1 Nsp1_C 194..300 CDD:309972 24/128 (19%)
SMC_N <213..392 CDD:330553 37/204 (18%)
NUP116NP_013762.1 Med15 358..>604 CDD:312941 26/79 (33%)
Nucleoporin_FG2 568..>720 CDD:406391 48/152 (32%)
Nucleoporin2 970..1108 CDD:397975
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.