DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup62 and NUP62CL

DIOPT Version :9

Sequence 1:NP_001286489.1 Gene:Nup62 / 36830 FlyBaseID:FBgn0034118 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_060151.2 Gene:NUP62CL / 54830 HGNCID:25960 Length:184 Species:Homo sapiens


Alignment Length:163 Identity:72/163 - (44%)
Similarity:90/163 - (55%) Gaps:11/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TSAPNTAATTTGLLGGSGLGAPKTTAAAST-TLTAAPSAIASTQGAAPAPTLSTGGAFANLTTET 196
            ||..| :.|:|..:|.|...:..|||..:| |.|...|.....|.    ..||.|  |.||...|
Human     4 TSISN-SLTSTAAIGLSFTTSTTTTATFTTNTTTTITSGFTVNQN----QLLSRG--FENLVPYT 61

  Fly   197 KTTDSSAVSTASQLSYHQLEEHINKWTLEFEEQEKVFTEQATQINAWDKLLISNNGKIVELNDAV 261
            .|.  |.|:| ..::|..||..||:|.||.|:|||.|..||||:||||..||.|...|..|:..|
Human    62 STV--SVVAT-PVMTYGHLEGLINEWNLELEDQEKYFLLQATQVNAWDHTLIENGEMIRILHGEV 123

  Fly   262 KKVKTDQQVLDQELEFIATQQKELEDSLGPLEK 294
            .|||.||:.|:|||:||.:||:|||..|..||:
Human   124 NKVKLDQKRLEQELDFILSQQQELEFLLTYLEE 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup62NP_001286489.1 Nsp1_C 194..300 CDD:309972 51/101 (50%)
SMC_N <213..392 CDD:330553 45/82 (55%)
NUP62CLNP_060151.2 Nsp1_C 61..173 CDD:309972 51/99 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148162
Domainoid 1 1.000 109 1.000 Domainoid score I6369
eggNOG 1 0.900 - - E1_KOG2196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002862
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102783
Panther 1 1.100 - - O PTHR12084
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.740

Return to query results.
Submit another query.