DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup62 and Nup58

DIOPT Version :9

Sequence 1:NP_001286489.1 Gene:Nup62 / 36830 FlyBaseID:FBgn0034118 Length:394 Species:Drosophila melanogaster
Sequence 2:NP_650821.2 Gene:Nup58 / 42342 FlyBaseID:FBgn0038722 Length:546 Species:Drosophila melanogaster


Alignment Length:417 Identity:111/417 - (26%)
Similarity:159/417 - (38%) Gaps:123/417 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PTTTAAPT---GGATSSFSFGLSTGT------PAAAPASGAATTAPATKTTFSFGTPAPTAGIGG 61
            |.||.||.   |.|||:.:||.:..|      |||.||.||....||      ||.||.|.|.| 
  Fly    26 PATTTAPPPSFGAATSTPTFGAAPATTSLFAAPAATPAFGAPAATPA------FGAPASTPGFG- 83

  Fly    62 GDADNSKAQAPPAFGFGLGSGTASAPLTLGTQAAANPASTTSAT-ATGTSAAPPAFGGFTAQPA- 124
                 :.:.|.|||      |||:|....|..||.:.....:|| |.|.:||.||||...|.|| 
  Fly    84 -----ATSTAAPAF------GTAAATPAFGIPAATSAFGAPAATPAFGAAAATPAFGAPAATPAF 137

  Fly   125 ------------------------------------ASVVPTIATSAPNTAATTTGLLGGSGLGA 153
                                                .:|.||.:.:.|.|:|.||. ....|.|.
  Fly   138 GAPAATSAFGAPAATTAFGAPASTQASAFGAPAPAVGTVAPTFSFATPATSAPTTA-PPAFGFGT 201

  Fly   154 PKTTAAASTTLTAAPSAIASTQG--AAPAPTLSTGGAFANLTTETKTTDSSAVSTASQLSYHQLE 216
            ..|||||     |.|::::|..|  :.|.|..:| .|..|..|.|.|..:...:|..:|......
  Fly   202 TATTAAA-----AMPASLSSGIGSFSFPKPQATT-AASLNFNTTTTTATAQPFNTGLKLGTTNAT 260

  Fly   217 EHINKWTLEFEEQEKVFTEQATQ----------------INAWDKLLISNNGKIVELNDAVKKVK 265
            ..:.        ...:|::.|.|                :.|....|..|.      .|.:|..:
  Fly   261 TTLG--------GGGIFSKPAGQAAAPAASTFVGLGGIDVTATQPKLGDNK------QDGIKIKE 311

  Fly   266 TDQQVLDQELEFI------ATQQKELEDSLG--------PLEKEFVNLPRVDMERSQTYLMVENL 316
            |  ||.|:.::.:      ..|||.:...:|        .:..|..|| :..::...|  :||..
  Fly   312 T--QVPDEIIKTVDGLKAYIKQQKTISSDIGRTSTSKFTNVSHEITNL-KWALQNMAT--LVEGS 371

  Fly   317 DTQLKQMSEDLKEIIDNLNEANKGQDT 343
            :.|::.|.::..:.|.:|..|.:.|||
  Fly   372 NQQIRLMRQETVKAIQSLEMAQRTQDT 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup62NP_001286489.1 Nsp1_C 194..300 CDD:309972 23/135 (17%)
SMC_N <213..392 CDD:330553 30/161 (19%)
Nup58NP_650821.2 PHA03247 <25..195 CDD:223021 60/187 (32%)
Nucleoporin_FG2 136..>525 CDD:374260 60/289 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R852
SonicParanoid 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.