DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup62 and Nup62cl

DIOPT Version :9

Sequence 1:NP_001286489.1 Gene:Nup62 / 36830 FlyBaseID:FBgn0034118 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_006234316.1 Gene:Nup62cl / 300923 RGDID:1564353 Length:273 Species:Rattus norvegicus


Alignment Length:275 Identity:94/275 - (34%)
Similarity:142/275 - (51%) Gaps:25/275 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PAASVVPTIATS---APNTAATTTGLLGGSGLGAPKTTAAASTTLTAAPSAIASTQGAAPAPTLS 184
            |:...||....|   :..|:.|||            ||...:||.|............|.:|.|:
  Rat     3 PSTPYVPACMASQELSSTTSTTTT------------TTVTTNTTTTITSGFNLYLTPPASSPWLN 55

  Fly   185 TGGAFANLTTETKTTDSSAVSTASQLSYHQLEEHINKWTLEFEEQEKVFTEQATQINAWDKLLIS 249
            ..|.....:..:..|.:|.|:..  ::|..|:..:|.|..:.:||||.:..||.|.|.|:..||.
  Rat    56 NTGLINMASLPSTMTVNSIVTPV--MTYGPLDSMVNNWHYQLQEQEKHYFYQAHQFNVWNHALIE 118

  Fly   250 NNGKIVELNDAVKKVKTDQQVLDQELEFIATQQKELEDSLGPLEKEF-------VNLPRVDMERS 307
            .:.:|..|::.|::||.||..|:|||:.|..||||||.:|.|:| ||       :.|..|:.|..
  Rat   119 TSNEIALLHNEVERVKRDQSRLEQELDLILLQQKELEHTLAPIE-EFLKEQNGPLKLLYVNKEYE 182

  Fly   308 QTYLMVENLDTQLKQMSEDLKEIIDNLNEANKGQDTTDPIIQIGKILNAHMNSLQWIESQSTNIS 372
            ..|.:.|.:|..||:||:|||:||..||...:..|.::|:.||.:||:||:.|||||...|..:.
  Rat   183 MIYRLAEVIDADLKRMSQDLKDIIIYLNSVIRPADASEPLEQICRILSAHLESLQWISHNSGIMH 247

  Fly   373 KKLEDIGKIQDSQKR 387
            ||:|::.|..:..:|
  Rat   248 KKVEEVAKAFEEYRR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup62NP_001286489.1 Nsp1_C 194..300 CDD:309972 41/112 (37%)
SMC_N <213..392 CDD:330553 73/182 (40%)
Nup62clXP_006234316.1 Nsp1_C 66..180 CDD:398645 43/116 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342032
Domainoid 1 1.000 109 1.000 Domainoid score I6230
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002862
OrthoInspector 1 1.000 - - otm46127
orthoMCL 1 0.900 - - OOG6_102783
Panther 1 1.100 - - O PTHR12084
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.