DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha44 and DET3

DIOPT Version :9

Sequence 1:NP_001137679.1 Gene:Vha44 / 36826 FlyBaseID:FBgn0262511 Length:836 Species:Drosophila melanogaster
Sequence 2:NP_563916.1 Gene:DET3 / 837840 AraportID:AT1G12840 Length:375 Species:Arabidopsis thaliana


Alignment Length:392 Identity:142/392 - (36%)
Similarity:207/392 - (52%) Gaps:51/392 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   466 FWHQASTTPRSSYRSFFNSLADQIYSKRS--TP-SQLNINN------------GFNLTPTHRSSP 515
            :| ..|...:.|..|.:|.|.:|| ||.|  || .:.||.|            |.:|..::    
plant     5 YW-VVSLPVKDSASSLWNRLQEQI-SKHSFDTPVYRFNIPNLRVGTLDSLLALGDDLLKSN---- 63

  Fly   516 VSSCCGSSSQGRSSPD----TDPAEPPEFPLSPAELPQYLTRFQWDMAKYPIKQSLRNIADIISK 576
             |...|.|.:.|...:    ....|.....:....:..|||||.||.||||....|:.:.|.|..
plant    64 -SFVEGVSQKIRRQIEELERISGVESNALTVDGVPVDSYLTRFVWDEAKYPTMSPLKEVVDNIQS 127

  Fly   577 QIGQIDGDLKTKSQAYNNLKGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKV 641
            |:.:|:.|||.:...|||::|.|..:.:|::|||..|:|::|||.|. |::||:|.|||.:|||.
plant   128 QVAKIEDDLKVRVAEYNNIRGQLNAINRKQSGSLAVRDLSNLVKPED-IVESEHLVTLLAVVPKY 191

  Fly   642 MANDWLTNYEKITDMIVPRSSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEE 706
            ...|||..||.:||.:|||||:.:.||.:|.|:.||||.:||:.|::.|||:.|.||||..:.|.
plant   192 SQKDWLACYETLTDYVVPRSSKKLFEDNEYALYTVTLFTRVADNFRIAAREKGFQVRDFEQSVEA 256

  Fly   707 LAAGKNEMTKLMTDKKKQFGPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIE 771
            ....|.|:.||:.|::.....|::|...::.|.|.:.:|..|:|.|.||::|||||..|.|.::.
plant   257 QETRKQELAKLVQDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRTFAESIMRYGLPPAFLACVLS 321

  Fly   772 PNKKSVKRLRDVL-------NQLYGHLD---GASAGGAVSSADNVDIPGLGFGQSEYFPYVFYKV 826
            |..||.|::|.:|       |.||...:   ||.||.|              |.||..|||.:.:
plant   322 PAVKSEKKVRSILERLCDSTNSLYWKSEEDAGAMAGLA--------------GDSETHPYVSFTI 372

  Fly   827 NI 828
            |:
plant   373 NL 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha44NP_001137679.1 V-ATPase_C 6..>98 CDD:301617
3-helical coiled coil 57..77 CDD:270211
V-ATPase_C <547..822 CDD:281248 116/284 (41%)
3-helical coiled coil 570..596 CDD:270211 10/25 (40%)
3-helical coiled coil 724..755 CDD:270211 8/30 (27%)
DET3NP_563916.1 V-ATPase_C 6..368 CDD:397366 139/383 (36%)
3-helical coiled coil 57..77 CDD:270211 5/24 (21%)
3-helical coiled coil 121..147 CDD:270211 10/25 (40%)
3-helical coiled coil 274..305 CDD:270211 8/30 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 218 1.000 Domainoid score I735
eggNOG 1 0.900 - - E1_COG5127
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1281
Inparanoid 1 1.050 282 1.000 Inparanoid score I870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016088at2759
OrthoFinder 1 1.000 - - FOG0001981
OrthoInspector 1 1.000 - - oto4068
orthoMCL 1 0.900 - - OOG6_101992
Panther 1 1.100 - - LDO PTHR10137
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1294
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.