DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vha44 and atp6v1c2

DIOPT Version :9

Sequence 1:NP_001137679.1 Gene:Vha44 / 36826 FlyBaseID:FBgn0262511 Length:836 Species:Drosophila melanogaster
Sequence 2:XP_021323179.1 Gene:atp6v1c2 / 100538220 ZFINID:ZDB-GENE-131127-65 Length:400 Species:Danio rerio


Alignment Length:304 Identity:151/304 - (49%)
Similarity:205/304 - (67%) Gaps:10/304 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 DPAEPPE--FPLSPAELPQYLTRFQWDMAKYPIKQSLRNIADIISKQIGQIDGDLKTKSQAYNNL 595
            ||..|.:  |.....:|..|:||||||.||||..|.|:.:|||||||:.|:|.:||::..:|::|
Zfish   101 DPKSPLKSYFQTVQVDLATYVTRFQWDRAKYPTAQPLKTLADIISKQVSQVDTELKSRRASYSHL 165

  Fly   596 KGNLQNLEKKKTGSLLTRNLADLVKKEHFILDSEYLTTLLVIVPKVMANDWLTNYEKITDMIVPR 660
            |.::|:.|:|..|||..|.|.::||||..:|:|||||||:|:||:.....|...||.::..:|||
Zfish   166 KASIQSYERKSEGSLQNRLLTNIVKKEDLVLNSEYLTTLIVLVPRTEYVLWQKTYESMSKFVVPR 230

  Fly   661 SSQLIQEDADYCLFNVTLFKKVAEEFKLHARERKFIVRDFVYNEEELAAGKNEMTKLMTDKKKQF 725
            ||:.:.|||:..:|.|||||.|..|||.:|::.||.||:  ||.||....|.::.:|..|||:..
Zfish   231 SSRKLAEDAEAGVFTVTLFKSVIAEFKANAKKHKFTVRE--YNLEEAEKQKQKIGRLALDKKELC 293

  Fly   726 GPLVRWLKVNFSEAFCALIHVKALRVFVESVLRYGLPVNFQAILIEPNKKSVKRLRDVLNQLYGH 790
            ...|.||||||||.|.|.||||.||.||||||||||||:|||||::|.||:||.|:..||.|:.|
Zfish   294 RTFVCWLKVNFSETFVAWIHVKVLRTFVESVLRYGLPVSFQAILLQPGKKNVKHLKQQLNSLFKH 358

  Fly   791 LDGASAGGAVSSAD--NVDIPGLGFGQSEYFPYVFYKVNIDMVE 832
            ||.|    |:|:..  .:|||..|.||.||:.|:.|.:.|::|:
Zfish   359 LDPA----AISTKPEMGLDIPDGGAGQQEYYSYICYPIKINLVD 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vha44NP_001137679.1 V-ATPase_C 6..>98 CDD:301617
3-helical coiled coil 57..77 CDD:270211
V-ATPase_C <547..822 CDD:281248 143/276 (52%)
3-helical coiled coil 570..596 CDD:270211 12/25 (48%)
3-helical coiled coil 724..755 CDD:270211 19/30 (63%)
atp6v1c2XP_021323179.1 V-ATPase_C 4..388 CDD:308707 147/292 (50%)
3-helical coiled coil 54..74 CDD:270211
3-helical coiled coil 140..166 CDD:270211 12/25 (48%)
3-helical coiled coil 292..323 CDD:270211 19/30 (63%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595551
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5127
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1016088at2759
OrthoFinder 1 1.000 - - FOG0001981
OrthoInspector 1 1.000 - - otm25146
orthoMCL 1 0.900 - - OOG6_101992
Panther 1 1.100 - - LDO PTHR10137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1294
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.710

Return to query results.
Submit another query.