DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZSCAN16

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001307484.1 Gene:ZSCAN16 / 80345 HGNCID:20813 Length:348 Species:Homo sapiens


Alignment Length:422 Identity:86/422 - (20%)
Similarity:141/422 - (33%) Gaps:145/422 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 KLATQE----EEGVTEPQELGGRNFFYPEIKIEEHELDTLPRIEILERSANTQENQDQLEGAARR 164
            ||..|:    .|.:|:..|| .|.:..||...:|..||.|    :||:..:.             
Human    46 KLCYQDAPGPREALTQLWEL-CRQWLRPECHTKEQILDLL----VLEQFLSI------------- 92

  Fly   165 LRKRLKA----------EDGSSVDKDKDEDGVEETAEPAPPKKRRGRPRKSDA---AVAPPQKPK 216
            |.|.|:|          |:..:|.:|.:.: ::|     |.|:..|...:.|.   .:||..:|.
Human    93 LPKDLQAWVRAHHPETGEEAVTVLEDLERE-LDE-----PGKQVPGNSERRDILMDKLAPLGRPY 151

  Fly   217 EDIQLDLKAEELDEFVDEETDPDFSCLVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRT 281
            |.:.:.|.                    |.....|.:.|....:.|.    ...|.| .:..|..
Human   152 ESLTVQLH--------------------PKKTQLEQEAGKPQRNGDK----TRTKNE-ELFQKED 191

  Fly   282 VVRPKKY-------KKRTKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCAICNLLVHN 339
            :.:.|::       ..:..|..||   |::::|...:                            
Human   192 MPKDKEFLGEINDRLNKDTPQHPK---SKDIIENEGR---------------------------- 225

  Fly   340 FTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQ 404
             :|.|:..|..::.|.     ||:.|:....|::|...|.....:||..|.|:|....||..|.:
Human   226 -SEWQQRERRRYKCDE-----CGKSFSHSSDLSKHRRTHTGEKPYKCDECGKAFIQRSHLIGHHR 284

  Fly   405 VHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMH 469
            ||                     |.:..:|             |.||.|.|.....|..| ..:|
Human   285 VH---------------------TGVKPYK-------------CKECGKDFSGRTGLIQH-QRIH 314

  Fly   470 DPESTIICDKCGKQMRTKIILKKHQELMHSDK 501
            ..|....||:||:..|....|.:||.:..::|
Human   315 TGEKPYECDECGRPFRVSSALIRHQRIHTANK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 13/79 (16%)
C2H2 Zn finger 330..351 CDD:275368 3/20 (15%)
C2H2 Zn finger 360..378 CDD:275368 5/17 (29%)
LIM 361..>400 CDD:295319 12/38 (32%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
zf-C2H2_8 389..465 CDD:292531 16/75 (21%)
C2H2 Zn finger 417..438 CDD:275368 2/20 (10%)
C2H2 Zn finger 448..465 CDD:275368 6/16 (38%)
C2H2 Zn finger 477..498 CDD:275368 8/20 (40%)
C2H2 Zn finger 511..532 CDD:275368
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
ZSCAN16NP_001307484.1 SCAN 37..148 CDD:128708 30/125 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..184 5/27 (19%)
COG5048 <183..323 CDD:227381 39/212 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 205..226 5/52 (10%)
C2H2 Zn finger 238..258 CDD:275368 6/24 (25%)
C2H2 Zn finger 266..286 CDD:275368 7/19 (37%)
C2H2 Zn finger 294..314 CDD:275368 7/20 (35%)
zf-C2H2 320..342 CDD:306579 8/21 (38%)
C2H2 Zn finger 322..342 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.