DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZFX

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001317256.1 Gene:ZFX / 7543 HGNCID:12869 Length:844 Species:Homo sapiens


Alignment Length:613 Identity:143/613 - (23%)
Similarity:232/613 - (37%) Gaps:168/613 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VQISKESDERICGRC--WKIVS--DFHTLHEFVSAAQSSLQETKVALMEDDPLTQETTSFPEIIK 104
            :.:.::.|::  |.|  :.::|  |...:....|:..:...|:::     ||...:.|. ||:||
Human   235 IPVDQQDDDK--GNCEDYLMISLDDAGKIEHDGSSGMTMDTESEI-----DPCKVDGTC-PEVIK 291

  Fly   105 L----ATQEEEGVTEPQELGGRNFFYPEIKIEEHELDTLPRIEILERSANTQENQDQLEGAARRL 165
            :    |...|:      :|||      .:.|.|.|.:....:|:|:::::.:..::::       
Human   292 VYIFKADPGED------DLGG------TVDIVESEPENDHGVELLDQNSSIRVPREKM------- 337

  Fly   166 RKRLKAEDGSSVDKDKDEDGVEETAEPAPPKKRRGRPRKSDAAVAPPQKPKEDIQLDLKAEELDE 230
             ..:...|....|:|.:   |.|.|:....:...|   :.|||.|.......:.|:|        
Human   338 -VYMTVNDSQPEDEDLN---VAEIADEVYMEVIVG---EEDAAAAAAAAAVHEQQMD-------- 387

  Fly   231 FVDEETDPDFSCLVPSDNSSEDDGGSDGFDSDSDFELDNGK-------QEFAVLPKRTVVRPKKY 288
                  |.:....:|...::.....|||.::      .||.       .|.|.|.:....:|   
Human   388 ------DNEIKTFMPIAWAAAYGNNSDGIEN------RNGTASALLHIDESAGLGRLAKQKP--- 437

  Fly   289 KKRTKPAEPKVRMSRELLEQRKKQQEEYDVIIAK--FFTSVLPCAICNLLVHNFTEMQRHHRLTH 351
            |||.:|               ..:|.:..:||..  ...:|.||                     
Human   438 KKRRRP---------------DSRQYQTAIIIGPDGHPLTVYPC--------------------- 466

  Fly   352 QVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDH-----FKCSVCE----KSFQNSRHLESHQQVHM 407
                   |.||:||..|..|..|:..|  |:|     ::|:.|:    |......|||||:   :
Human   467 -------MICGKKFKSRGFLKRHMKNH--PEHLAKKKYRCTDCDYTTNKKISLHNHLESHK---L 519

  Fly   408 DPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKF-TCSECNKKFLTERKLKNHMSSMHDP 471
            ....:....||.|.|.|....|:..||: .|..|...|. .|..|..:...:..|..|:.::|..
Human   520 TSKAEKAIECDECGKHFSHAGALFTHKM-VHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSK 583

  Fly   472 ESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKS------ 530
            ....||.:|||..|....||||..:...:||      .|||.|.......:.||.|:|:      
Human   584 NFPHICVECGKGFRHPSELKKHMRIHTGEKP------YQCQYCEYRSADSSNLKTHVKTKHSKEM 642

  Fly   531 ----------------------IHVESAGEHRCHICAKVSPNARALRRHIYHNHECERKFKCTMC 573
                                  ||.||. .|:|..|...|.|:..|:|||...|..:...||.||
Human   643 PFKCDICLLTFSDTKEVQQHALIHQESK-THQCLHCDHKSSNSSDLKRHIISVHTKDYPHKCDMC 706

  Fly   574 EKAFKRPQELKEHTSTHTGEVLYTCPNC 601
            :|.|.||.|||:|.:.|.|:.::.|.:|
Human   707 DKGFHRPSELKKHVAAHKGKKMHQCRHC 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071 6/40 (15%)
FYDLN_acid <191..268 CDD:302856 12/76 (16%)
C2H2 Zn finger 330..351 CDD:275368 1/20 (5%)
C2H2 Zn finger 360..378 CDD:275368 7/17 (41%)
LIM 361..>400 CDD:295319 14/47 (30%)
C2H2 Zn finger 386..406 CDD:275368 8/23 (35%)
zf-C2H2_8 389..465 CDD:292531 21/80 (26%)
C2H2 Zn finger 417..438 CDD:275368 8/20 (40%)
C2H2 Zn finger 448..465 CDD:275368 3/16 (19%)
C2H2 Zn finger 477..498 CDD:275368 9/20 (45%)
C2H2 Zn finger 511..532 CDD:275368 7/48 (15%)
C2H2 Zn finger 541..562 CDD:275368 8/20 (40%)
C2H2 Zn finger 570..590 CDD:275368 11/19 (58%)
C2H2 Zn finger 598..619 CDD:275368 2/4 (50%)
ZFXNP_001317256.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.