DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and Rpl24

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_077180.1	Gene:	Rpl24 / 68193	MGIID:	1915443	Length:	157	Species:	Mus musculus

Alignment Length:	85	Identity:	23/85 - (27%)
Similarity:	30/85 - (35%)	Gaps:	27/85 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   265 FELDNGKQEFAVLPKR-------TVVRPKKYKKRTKPAEPKVRMSRELLEQR------------- 309
            |:..|.|.|.|.|.||       ||:..:|:||.......|.|..|.:..||
Mouse    29 FQFLNAKCESAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAK 93

  Fly   310 -------KKQQEEYDVIIAK 322
                   :|.|.|..:..||
Mouse    94 RNQKPEVRKAQREQAIRAAK 113

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856	1/2 (50%)
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368
		C2H2 Zn finger	541..562	CDD:275368
		C2H2 Zn finger	570..590	CDD:275368
		C2H2 Zn finger	598..619	CDD:275368
Rpl24	NP_077180.1	Ribosomal_L24e	2..64	CDD:395998	13/34 (38%)
Rpl24	NP_077180.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	106..157		3/8 (38%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910