DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and Zfp541

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_001092747.1	Gene:	Zfp541 / 666528	MGIID:	3647699	Length:	1363	Species:	Mus musculus

Alignment Length:	95	Identity:	31/95 - (32%)
Similarity:	44/95 - (46%)	Gaps:	7/95 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly   541 CHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTC--PNCPM 603
            |.:|.||..:|.:|.:| |..|..|||..|.:|.|||||...|..|..||.....:.|  ..|..
Mouse   142 CSLCGKVFSSASSLSKH-YLTHSQERKHVCKVCSKAFKRQDHLTGHMLTHQKTKPFVCIEQGCSK 205

  Fly   604 TFFCSANMYKHRQRLHRAQYEADKNQPKPP 633
            : :|.   |:..:|.:..|:.....:..||
Mouse   206 S-YCD---YRSLRRHYEVQHGVCILKETPP 231

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368
		C2H2 Zn finger	541..562	CDD:275368	8/20 (40%)
		C2H2 Zn finger	570..590	CDD:275368	9/19 (47%)
		C2H2 Zn finger	598..619	CDD:275368	5/22 (23%)
Zfp541	NP_001092747.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..23
		COG5236	<80..>329	CDD:227561	31/95 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	106..137
		C2H2 Zn finger	142..162	CDD:275368	8/20 (40%)
		zf-C2H2	142..162	CDD:278523	8/20 (40%)
		zf-H2C2_2	154..179	CDD:290200	12/25 (48%)
		zf-C2H2_6	168..192	CDD:290623	11/23 (48%)
		C2H2 Zn finger	170..190	CDD:275368	9/19 (47%)
		C2H2 Zn finger	198..216	CDD:275368	4/21 (19%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	232..269		31/95 (33%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	286..387
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	440..532
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	574..741
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	935..978
		ELM2	1065..1120	CDD:279754
		SANT	1175..1219	CDD:197842
		SANT	1175..1218	CDD:304392
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1243..1298
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1343..1363
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910