DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and ZNF444

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_060807.2	Gene:	ZNF444 / 55311	HGNCID:	16052	Length:	327	Species:	Homo sapiens

Alignment Length:	196	Identity:	47/196 - (23%)
Similarity:	64/196 - (32%)	Gaps:	61/196 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   447 TCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQC 511
            :|.||.|..|....|..|..| |..|....|.:|||..|.|..|::|::........|.|.|:.
Human   180 SCPECGKTSLKPAHLLRHRQS-HSGEKPHACPECGKAFRRKEHLRRHRDTHPGSPGSPGPALRP- 242

  Fly   512 QICGAWLKGMTGLKQHMKSIHVESAGEHRCHICAKVSPNARALRRHIYHNHECERKFKCTMCEKA 576
                                           :.|:..|:|                  |..|.|.
Human   243 -------------------------------LPAREKPHA------------------CCECGKT 258

  Fly   577 FKRPQELKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQRLH-RAQYEA--------DKNQPKP 632
            |...:.|..|..||:|...:.|..|...|....::.:| ||:| ||...|        |...|.|
Human   259 FYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRH-QRIHGRAAASAQGAVAPGPDGGGPFP 322

  Fly   633 P 633
            |
Human   323 P 323

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531	6/17 (35%)
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368	6/16 (38%)
		C2H2 Zn finger	477..498	CDD:275368	8/20 (40%)
		C2H2 Zn finger	511..532	CDD:275368	0/20 (0%)
		C2H2 Zn finger	541..562	CDD:275368	3/20 (15%)
		C2H2 Zn finger	570..590	CDD:275368	6/19 (32%)
		C2H2 Zn finger	598..619	CDD:275368	6/20 (30%)
ZNF444	NP_060807.2	SCAN	21..98	CDD:366881
		PRK14959	<60..>182	CDD:184923	0/1 (0%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	101..171
		COG5048	<179..>280	CDD:227381	33/150 (22%)
		C2H2 Zn finger	181..201	CDD:275368	8/20 (40%)
		C2H2 Zn finger	209..229	CDD:275368	8/19 (42%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	220..243		5/54 (9%)
		C2H2 Zn finger	252..272	CDD:275368	6/19 (32%)
		zf-C2H2	278..300	CDD:333835	6/22 (27%)
		C2H2 Zn finger	280..300	CDD:275368	6/20 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	305..327		5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910