DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and zgc:112083

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001017764.1 Gene:zgc:112083 / 550461 ZFINID:ZDB-GENE-050417-284 Length:504 Species:Danio rerio


Alignment Length:377 Identity:91/377 - (24%)
Similarity:137/377 - (36%) Gaps:111/377 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 CNLLVHNFTEMQRHHRLTHQVDPGYMMC----CGRKFTQRKVLAEHVLVHWN-------PDHFKC 386
            |...:||.:       |...|..|: :|    |...|...:....||.:|.:       ||..:.
Zfish   101 CTQDLHNSS-------LVPDVSEGF-VCQWQHCESSFNNPEWFYRHVDMHAHCTELQPLPDRQQA 157

  Fly   387 SVCEKS---------FQNSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKS 442
            ..|..|         ::...||.||.|..:       .:|..|...|.|.|     |...|:.:.
Zfish   158 LFCSWSGCDAFFKIKYRLREHLRSHTQERL-------VACPTCGCMFSSNT-----KFFDHIQRQ 210

  Fly   443 ---EFKFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRP 504
               |...||..|:|.|..||.|::|:....:.....:||.....:.|   ||.|.:..|.|: ||
Zfish   211 AEPEDSLTCGHCDKAFANERLLRDHVRQHVNHIKCPLCDMTCTSLST---LKIHIKFRHCDE-RP 271

  Fly   505 EPELQQCQICGAWLKGMTGLKQHMKSIHVESAGEHRCHI--CAKVSPNARALRRHIYHNHECER- 566
            .|    |..|.:..|....|::||:: |.|.|..| |.:  |...|..|..:.:|....||... 
Zfish   272 FP----CDFCESSFKNQHDLRRHMET-HNEGAAYH-CTVEGCGYSSRMAHTMNQHYKRAHEDNMV 330

  Fly   567 -KFKCTMCEKAF----------KRPQELKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQ---- 616
             ::||.:|:|.|          ::..:|| ..|.|                 |...||..:    
Zfish   331 PQYKCHLCDKTFSWCYTLTLHLRKKHQLK-WPSGH-----------------SRFRYKKDEDGYL 377

  Fly   617 RLHRAQYE------------ADKNQPK----PPN-----ILKISRNAST-QN 646
            ||:..::|            |:|..|:    |.|     :|.:....|| ||
Zfish   378 RLNMVRFETVEVTEELIKNMAEKRTPRKTSAPTNHSKEPLLHLDSGTSTPQN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 4/17 (24%)
C2H2 Zn finger 360..378 CDD:275368 5/21 (24%)
LIM 361..>400 CDD:295319 10/54 (19%)
C2H2 Zn finger 386..406 CDD:275368 7/28 (25%)
zf-C2H2_8 389..465 CDD:292531 23/87 (26%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 448..465 CDD:275368 7/16 (44%)
C2H2 Zn finger 477..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 511..532 CDD:275368 6/20 (30%)
C2H2 Zn finger 541..562 CDD:275368 5/22 (23%)
C2H2 Zn finger 570..590 CDD:275368 7/29 (24%)
C2H2 Zn finger 598..619 CDD:275368 4/24 (17%)
zgc:112083NP_001017764.1 C2H2 Zn finger 163..182 CDD:275368 3/18 (17%)
C2H2 Zn finger 190..211 CDD:275368 7/25 (28%)
C2H2 Zn finger 219..239 CDD:275368 8/19 (42%)
COG5236 <234..>356 CDD:227561 34/131 (26%)
C2H2 Zn finger 245..266 CDD:275368 6/23 (26%)
C2H2 Zn finger 274..294 CDD:275368 6/20 (30%)
C2H2 Zn finger 302..320 CDD:275370 4/17 (24%)
C2H2 Zn finger 335..353 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.