DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and CG17829

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_652054.1 Gene:CG17829 / 47718 FlyBaseID:FBgn0025635 Length:467 Species:Drosophila melanogaster


Alignment Length:426 Identity:81/426 - (19%)
Similarity:146/426 - (34%) Gaps:126/426 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 PKRTVVRPKKYKKRTKPAEPKV----RMSREL--------------LEQRKKQQEEYDVIIAKFF 324
            |:.:|..|:...||.||||.::    |..:|:              ||...|.|::... .|:..
  Fly     4 PQSSVPAPQPPGKRKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGA-HAEHT 67

  Fly   325 TSVLPCAICNLLVHNFTEMQRHH-------------RLTHQVDPGYMMC---------------- 360
            ........|:....|..|.:||.             :|...:.|....|                
  Fly    68 EHQCTWNSCDFRTENQVEFERHSYYHGYYLNLLLQGKLECDLHPEIPACTAPARLMEKLPALGQN 132

  Fly   361 -------CGRKFTQRKVLAEHVLVH---------------------WNPDHFKCSVCEKSFQNSR 397
                   |.|:|.......:|::.|                     |       ::|.|...|..
  Fly   133 FRCGWTDCEREFVSIVEFQDHIVKHALFEYDIQKTPEDERPKTMCNW-------AMCHKHMGNKY 190

  Fly   398 HLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLK 462
            .|..|...|.:   |...:|..|.:.|.:||.:..| |.:....:...|.|::|.|.|.|::.||
  Fly   191 RLIEHISTHSN---KKQVACFHCGELFRTKTTLFDH-LRRQPENNTNSFQCAQCFKFFATKKLLK 251

  Fly   463 NHM-------------------SSM-------HDPESTIICDKCGKQMRTKIILKKHQELMHSDK 501
            :|:                   ||:       |..:..:.|.:|..:...:..|.||.:::||  
  Fly   252 SHVVRHVNCYKCTMCDMTCSSASSLTTHIRYRHLKDKPLKCSECDTRCVRESDLAKHVQIVHS-- 314

  Fly   502 PRPEPELQQCQ--ICGAWLKGMTGLKQHMKSIHVESAGEHRCHICAKVSPNARALRRHIYHNH-- 562
                ..:.||:  .|...::..|.:::|...:|..:...:.||.|.:...:.::|..|:...|  
  Fly   315 ----KTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYACHCCERFFKSGKSLSAHLMKKHGF 375

  Fly   563 ---ECERKFKCTMCEKAFKRPQELKEHTSTHTGEVL 595
               ...::|...:.|..|.|.:..:..:...|.::|
  Fly   376 RLPSGHKRFTYRVDENGFYRLETTRLESLEVTQQIL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 6/33 (18%)
C2H2 Zn finger 360..378 CDD:275368 5/40 (13%)
LIM 361..>400 CDD:295319 9/59 (15%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-C2H2_8 389..465 CDD:292531 22/75 (29%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..465 CDD:275368 7/16 (44%)
C2H2 Zn finger 477..498 CDD:275368 5/20 (25%)
C2H2 Zn finger 511..532 CDD:275368 4/22 (18%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 570..590 CDD:275368 3/19 (16%)
C2H2 Zn finger 598..619 CDD:275368
CG17829NP_652054.1 C2H2 Zn finger 182..199 CDD:275368 5/16 (31%)
C2H2 Zn finger 207..225 CDD:275368 6/18 (33%)
C2H2 Zn finger 237..257 CDD:275368 8/19 (42%)
C2H2 Zn finger 263..284 CDD:275368 2/20 (10%)
C2H2 Zn finger 292..311 CDD:275368 5/18 (28%)
C2H2 Zn finger 352..373 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.