DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZNF727

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001152994.1 Gene:ZNF727 / 442319 HGNCID:22785 Length:499 Species:Homo sapiens


Alignment Length:305 Identity:88/305 - (28%)
Similarity:131/305 - (42%) Gaps:20/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 CAICNLLVHNFTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQ 394
            |..|......|:.:..|:|:.....|.....||:.||....|.:|...|.....:||..|.|:|:
Human   202 CEECGKACKKFSNLTEHNRVHTGKKPYKCEECGKTFTCSSALTKHKRNHTGDRPYKCEECHKAFR 266

  Fly   395 NSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTER 459
            ....|..|:::|..   :..:.|..|.|.|...:.:..|   |.:...|..:.|:||.|.|:...
Human   267 CCSDLTKHKRIHTG---EKPYKCKECHKAFRCCSDLTKH---KRIHTGEKPYKCNECGKAFMWIS 325

  Fly   460 KLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGL 524
            .|..| :.:|..|...||::|||.......|..|:.:....:|      .:|:.||...|..:.|
Human   326 ALSQH-NRIHTGEKPYICEECGKAFTYSSTLISHKRIHMELRP------YKCEECGKTFKWFSDL 383

  Fly   525 KQHMKSIHVESAGE--HRCHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHT 587
            ..| |.||   .||  ::|..|.|....:..|.:| ...|...|.:||..|.|.||...:|..|.
Human   384 TNH-KRIH---TGEKPYKCEECGKSFTCSSNLIKH-KRIHMEVRPYKCEECGKTFKWFPDLTNHK 443

  Fly   588 STHTGEVLYTCPNCPMTFFCSANMYKHRQRLHRAQYEADKNQPKP 632
            ..||||..|.|..|..||.||:::.||::.....:..:.||..||
Human   444 RIHTGEKPYKCEECGKTFTCSSSLIKHKRSHTGDRPTSAKNVAKP 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 5/20 (25%)
C2H2 Zn finger 360..378 CDD:275368 6/17 (35%)
LIM 361..>400 CDD:295319 12/38 (32%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-C2H2_8 389..465 CDD:292531 19/75 (25%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 6/16 (38%)
C2H2 Zn finger 477..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 511..532 CDD:275368 7/20 (35%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 570..590 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..619 CDD:275368 8/20 (40%)
ZNF727NP_001152994.1 KRAB 4..64 CDD:214630
KRAB 4..43 CDD:279668
C2H2 Zn finger 148..167 CDD:275370
C2H2 Zn finger 175..194 CDD:275368
C2H2 Zn finger 202..222 CDD:275368 5/19 (26%)
zf-H2C2_2 214..239 CDD:290200 6/24 (25%)
COG5048 <226..409 CDD:227381 54/199 (27%)
C2H2 Zn finger 230..250 CDD:275368 6/19 (32%)
zf-H2C2_2 242..267 CDD:290200 8/24 (33%)
C2H2 Zn finger 258..278 CDD:275368 6/19 (32%)
zf-H2C2_2 270..295 CDD:290200 7/27 (26%)
C2H2 Zn finger 286..306 CDD:275368 6/22 (27%)
zf-H2C2_2 298..321 CDD:290200 7/25 (28%)
C2H2 Zn finger 314..334 CDD:275368 7/20 (35%)
zf-H2C2_2 326..351 CDD:290200 9/25 (36%)
C2H2 Zn finger 342..362 CDD:275368 6/19 (32%)
C2H2 Zn finger 370..390 CDD:275368 7/20 (35%)
zf-H2C2_2 382..407 CDD:290200 10/28 (36%)
C2H2 Zn finger 398..418 CDD:275368 5/20 (25%)
C2H2 Zn finger 426..446 CDD:275368 7/19 (37%)
zf-H2C2_2 438..463 CDD:290200 11/24 (46%)
C2H2 Zn finger 454..474 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.