DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and Prdm13

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster


Alignment Length:470 Identity:86/470 - (18%)
Similarity:148/470 - (31%) Gaps:150/470 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 SSVDKDKDEDGVEETAEPAPPKKRRGRPRKSDAAVAPPQKPKEDIQLDLKAEELDEFVDEETDPD 239
            :|:.....|..:..|...|.|.||...........|....||:...:.:....|..         
  Fly    34 TSMTTSSTETTLTATTSTASPAKRMRMSNPRPGVYASQYTPKDTCSMAIPTSALLG--------- 89

  Fly   240 FSCLVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVRPKKYKK---------RTKPA 295
             |.::|:|.|.            |..:|.||:    ::...:::|..|..:         .....
  Fly    90 -STVMPTDGSR------------SHCQLSNGE----LIVSGSLLRQIKLSEDVYSFNAIFELHGG 137

  Fly   296 EPKVRMSRELLEQRKKQQEEYDVIIAKF-----------FTSVL--------PCAICNLLVHNFT 341
            :.:||:.|::..:        |.|:|.|           |.:.|        .|.:|:|......
  Fly   138 QVRVRLVRDVARE--------DEIVAWFGEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPH 194

  Fly   342 EMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRH-------- 398
            .::.|..|.          |||.       |..:|  |...|:......:|...::|        
  Fly   195 PLKIHLALG----------CGRS-------AMDIL--WMRLHYALKAAARSHTETQHSPIPATSS 240

  Fly   399 LESHQQVH------------MDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSEC 451
            ..|....|            ..|...||.|..:...| .:.|.:.|      :|..... |....
  Fly   241 TSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVT-TAATPLSY------LPSMSMA-TAPLS 297

  Fly   452 NKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGA 516
            ........:::..:|:|...:...:|..|||....|..||.|.......||      .:|:.|..
  Fly   298 TNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKP------LKCKFCLR 356

  Fly   517 WLKGMTGLKQHMKSIHVE-----SAG-----------------------EHRCHICAKVSPNARA 553
            .....:.|.:|:: :|::     |||                       :::||:|.|..|..|.
  Fly   357 PFGDPSNLNKHVR-LHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRD 420

  Fly   554 LRRHI------YHNH 562
            |:||:      :|:|
  Fly   421 LQRHMETRHGGHHSH 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 13/76 (17%)
C2H2 Zn finger 330..351 CDD:275368 5/20 (25%)
C2H2 Zn finger 360..378 CDD:275368 5/17 (29%)
LIM 361..>400 CDD:295319 9/46 (20%)
C2H2 Zn finger 386..406 CDD:275368 3/27 (11%)
zf-C2H2_8 389..465 CDD:292531 13/95 (14%)
C2H2 Zn finger 417..438 CDD:275368 3/20 (15%)
C2H2 Zn finger 448..465 CDD:275368 0/16 (0%)
C2H2 Zn finger 477..498 CDD:275368 8/20 (40%)
C2H2 Zn finger 511..532 CDD:275368 4/20 (20%)
C2H2 Zn finger 541..562 CDD:275368 10/26 (38%)
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 21/113 (19%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 336..358 CDD:290200 7/27 (26%)
C2H2 Zn finger 351..371 CDD:275368 4/20 (20%)
zf-C2H2 406..427 CDD:278523 9/20 (45%)
C2H2 Zn finger 408..427 CDD:275368 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.