| Sequence 1: | NP_611118.3 | Gene: | CG4282 / 36825 | FlyBaseID: | FBgn0034114 | Length: | 652 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001023030.2 | Gene: | ZK686.5 / 3565160 | WormBaseID: | WBGene00022795 | Length: | 263 | Species: | Caenorhabditis elegans |
| Alignment Length: | 251 | Identity: | 59/251 - (23%) |
|---|---|---|---|
| Similarity: | 90/251 - (35%) | Gaps: | 70/251 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 223 LKA-EELDEFVDEET----------------DPDFSCLVP-----SDNSSEDDG------GSDGF 259
Fly 260 DSDSDF-------ELDNGKQEFAVLPKRTVVRPKKYKKRTKPAEPKVRMSRELLEQRKKQQEEYD 317
Fly 318 VIIAKFFTSV----LPCAICNLLVHNFTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEH-VLV 377
Fly 378 HWNPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYH 433 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4282 | NP_611118.3 | zf-AD | 7..81 | CDD:285071 | |
| FYDLN_acid | <191..268 | CDD:302856 | 18/79 (23%) | ||
| C2H2 Zn finger | 330..351 | CDD:275368 | 5/20 (25%) | ||
| C2H2 Zn finger | 360..378 | CDD:275368 | 5/18 (28%) | ||
| LIM | 361..>400 | CDD:295319 | 12/39 (31%) | ||
| C2H2 Zn finger | 386..406 | CDD:275368 | 5/19 (26%) | ||
| zf-C2H2_8 | 389..465 | CDD:292531 | 13/45 (29%) | ||
| C2H2 Zn finger | 417..438 | CDD:275368 | 6/17 (35%) | ||
| C2H2 Zn finger | 448..465 | CDD:275368 | |||
| C2H2 Zn finger | 477..498 | CDD:275368 | |||
| C2H2 Zn finger | 511..532 | CDD:275368 | |||
| C2H2 Zn finger | 541..562 | CDD:275368 | |||
| C2H2 Zn finger | 570..590 | CDD:275368 | |||
| C2H2 Zn finger | 598..619 | CDD:275368 | |||
| ZK686.5 | NP_001023030.2 | C2H2 Zn finger | 173..194 | CDD:275368 | 5/20 (25%) |
| C2H2 Zn finger | 201..221 | CDD:275368 | 5/19 (26%) | ||
| zf-C2H2_8 | <204..251 | CDD:292531 | 13/45 (29%) | ||
| C2H2 Zn finger | 232..248 | CDD:275368 | 5/15 (33%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000909 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||