DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and kmg

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_609604.1 Gene:kmg / 34706 FlyBaseID:FBgn0032473 Length:747 Species:Drosophila melanogaster


Alignment Length:635 Identity:112/635 - (17%)
Similarity:191/635 - (30%) Gaps:222/635 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 RRLRKRLKAEDGSSVDKDKDEDGVEETAEPAPPKKRRG-----RPRKSDAAV----APPQ----- 213
            ::|.:.:|...|.|      :||.......|.|:.:|.     |.|:.:.::    |..|     
  Fly   160 QKLVRHMKMVHGCS------DDGGAVQGSGAQPRGKRNLSREVRKRRLEESIEGQGATGQCLDLS 218

  Fly   214 --------KPKEDIQLDLKAEELDEFVDEETDPDFSCLVPSDNSSEDDGGSDGFDSDSDFELDNG 270
                    .|.|.::::|:.:|:.             |:.|                  .:..|.
  Fly   219 VLRMIQNGPPLEQLKVELQQQEMQ-------------LLAS------------------VQAYNR 252

  Fly   271 KQEF----AVLPKRTVVRPKKYKKRTKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCA 331
            :||.    .::.....:....|:.:||...||...|.:|.:|......|.        |:..|..
  Fly   253 QQEMLQLQQIVESHDNIFSMAYEFQTKLMPPKQAESLKLEQQNSSSDSEE--------TAKSPSP 309

  Fly   332 ICNLLVHNFTEMQRHHRLTHQVDPGYMMC--CGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQ 394
            ....||....:.|               |  |......|....:||..|..| ..|||.|:....
  Fly   310 DTRELVSGKEQFQ---------------CQKCSYSTPIRARFKKHVKYHSMP-LIKCSSCDFHTP 358

  Fly   395 NSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVP------------------- 440
            ...:|:.|.:.|   .....|.|..|..:...|.::..|:.|.|||                   
  Fly   359 YKWNLDRHTKNH---GANGHFKCSCCDFSTDIKQSLTIHESNHHVPMPVHQMGNRSRDEAEDLVD 420

  Fly   441 -------KSE-FK------------------FTCSECNKKFLTERKLKNHMS------------- 466
                   |.| ||                  ..||.|.|:.....:|.||:.             
  Fly   421 QQSSGSRKPETFKNGGATVASTESLLPRTSGIVCSHCQKRVGNAMQLINHLQVCTLALHNTTQLQ 485

  Fly   467 -------SMHD---PESTIICDKCGKQMR------TKIILKKHQELMHSDKPRPEPELQQCQICG 515
                   .:||   |.:......||.:..      |:::.::.::|      .|..::.:|..|.
  Fly   486 ASINAEVDLHDEDFPNAPTDLSYCGVETAPGYGEVTEVLPEEPEDL------APLKKVFKCPHCS 544

  Fly   516 AWLKGMTGLKQHMKSIHVESAGEHRCHICAKVSP---------NARALR------RHIYHNHECE 565
            .|  ..|..:.|:..:...:.....|.:||..|.         ..:|||      ..:..|.|..
  Fly   545 FW--AATASRFHVHIVGHLNRKPFECSLCAYRSNWRWDITKHIRLKALRDRSHNQAQVLMNDETG 607

  Fly   566 R----KFK--CTMCEKAFKR----------------PQELKEHTSTHTGEVLYTCPNCPMTFFCS 608
            |    |:.  .||.:.:.::                |::|.:|....|.|::....:...|  .:
  Fly   608 RRNYAKYNQYLTMMKVSAEQLADSKGMRTGEMIVMPPEKLDDHHPMETEEIIEMVDSAHST--SA 670

  Fly   609 ANMYKHRQ--------RLHRAQYEADKNQPK-PPNILKISRNASTQNKPK 649
            .::.|.|.        .......|..|.:|. .|...|...::....|||
  Fly   671 LDLRKPRDDQTEDLAGNSDELPQEGAKTEPNLEPLSFKSLNSSQVMPKPK 720

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 13/98 (13%)
C2H2 Zn finger 330..351 CDD:275368 3/20 (15%)
C2H2 Zn finger 360..378 CDD:275368 5/19 (26%)
LIM 361..>400 CDD:295319 10/38 (26%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-C2H2_8 389..465 CDD:292531 23/120 (19%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 6/16 (38%)
C2H2 Zn finger 477..498 CDD:275368 4/26 (15%)
C2H2 Zn finger 511..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 541..562 CDD:275368 7/35 (20%)
C2H2 Zn finger 570..590 CDD:275368 5/35 (14%)
C2H2 Zn finger 598..619 CDD:275368 3/28 (11%)
kmgNP_609604.1 C2H2 Zn finger 540..560 CDD:275370 5/21 (24%)
C2H2 Zn finger 568..586 CDD:275370 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.