DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and ab

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_476562.1	Gene:	ab / 34560	FlyBaseID:	FBgn0264442	Length:	904	Species:	Drosophila melanogaster

Alignment Length:	84	Identity:	26/84 - (30%)
Similarity:	36/84 - (42%)	Gaps:	9/84 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly   449 SECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQI 513
            |..|..|::.|.|:..:.:. ||..   |.||||..|:...|:.|.|..|:..|.     .:|.:
  Fly   522 SGINSDFVSRRSLEMRVRAT-DPRP---CPKCGKIYRSAHTLRTHLEDKHTVCPG-----YRCVL 577

  Fly   514 CGAWLKGMTGLKQHMKSIH 532
            ||...|....|..||...|
  Fly   578 CGTVAKSRNSLHSHMSRQH 596

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531	5/15 (33%)
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368	5/15 (33%)
		C2H2 Zn finger	477..498	CDD:275368	9/20 (45%)
		C2H2 Zn finger	511..532	CDD:275368	7/20 (35%)
		C2H2 Zn finger	541..562	CDD:275368
		C2H2 Zn finger	570..590	CDD:275368
		C2H2 Zn finger	598..619	CDD:275368
ab	NP_476562.1	BTB	93..189	CDD:279045
		BTB	104..189	CDD:197585
		zf-Di19	545..597	CDD:283297	19/60 (32%)
		C2H2 Zn finger	546..567	CDD:275371	9/20 (45%)
		C2H2 Zn finger	575..596	CDD:275371	7/20 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.910