DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and CG12299

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_609448.1 Gene:CG12299 / 34483 FlyBaseID:FBgn0032295 Length:736 Species:Drosophila melanogaster


Alignment Length:579 Identity:120/579 - (20%)
Similarity:215/579 - (37%) Gaps:122/579 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PLTQETTSFPEIIKLATQEEEGVTEPQELGGR-----NFFYPEIKIEEHELDTL----------- 139
            |:.|:|...|:......|::....:|.:|...     .||...:.:.:| ::||           
  Fly    18 PILQQTHLLPQQAPNPPQQQPQQPQPPDLTFHCMCCAEFFVHPLALYQH-MNTLHPHEPGNGQQE 81

  Fly   140 ----------------PRIEILERSANTQENQDQLEGAARRLRKRLKAEDGSSVDKDKDEDGVEE 188
                            |..|:.|      :..|..:|:|.      ...|.||...|.|:|..::
  Fly    82 QESPGDESEDYSWIFEPVCELAE------DGSDSSDGSAS------SGSDSSSSSDDDDDDDDDD 134

  Fly   189 TAEPAPPKKRRGR-----PRKSDAAVAPPQKPKEDIQLDLKAEELDEFVDEETDPDFSCLVPSDN 248
            ::..:........     |..|::.....|:..:.:...:.....:||..:.|||..|..:    
  Fly   135 SSSSSSSSSNSSSSSSSVPTTSNSNTQQSQESVQPLHGLVAGPGYNEFQLQMTDPRESTSI---- 195

  Fly   249 SSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVRPKKYKKRTKPAEPKVRMSRELLEQRKKQQ 313
                                     |.|.|..:|...::.........|.:.:....:::|:.::
  Fly   196 -------------------------FMVQPTVSVTPLQQLLPPAPTVSPGLGLQSTPIKRRRGRR 235

  Fly   314 EEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHVLVH 378
            ......:..      |....|         |:..:.||         |...|.....|::||..|
  Fly   236 SNIGAPVMD------PALNGN---------QKCFQCTH---------CEASFPNAGDLSKHVRSH 276

  Fly   379 WNPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSE 443
            .....|:||:|:|:|.:...|.:|.::|   :.:..:.|:||.|.|...:::..|..:..|.|..
  Fly   277 ITNKPFQCSICQKTFTHIGSLNTHIRIH---SGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPH 338

  Fly   444 FKFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPEL 508
               .|.:|:|.|:....|..|..:...|..|.||.:|.::.:.:.:|.:|.. ||:     :..:
  Fly   339 ---QCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMR-MHT-----QELV 394

  Fly   509 QQCQICGAWLKGMTGLKQHMKSIHVESAGE--HRCHICAKVSPNARALRRHIYHNHECERKFKCT 571
            .||.||....:..:.|.||||: |:   ||  ..|.:|.:....:.:|..|: ..|..|:.|:|.
  Fly   395 YQCAICREAFRASSELVQHMKN-HM---GEKPFTCSLCDRSFTQSGSLNIHM-RIHTGEKPFQCK 454

  Fly   572 MCEKAFKRPQELKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQRLHRAQYEADKNQP 630
            :|:|.|.:...|..|...|.||..|.||.|..::...|.:.||.|....|...:....|
  Fly   455 LCDKCFTQASSLSVHMKIHAGEKPYPCPICGKSYSQQAYLNKHIQAHQMASAASASTSP 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 9/81 (11%)
C2H2 Zn finger 330..351 CDD:275368 2/20 (10%)
C2H2 Zn finger 360..378 CDD:275368 5/17 (29%)
LIM 361..>400 CDD:295319 12/38 (32%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
zf-C2H2_8 389..465 CDD:292531 19/75 (25%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 4/20 (20%)
C2H2 Zn finger 511..532 CDD:275368 8/20 (40%)
C2H2 Zn finger 541..562 CDD:275368 4/20 (20%)
C2H2 Zn finger 570..590 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..619 CDD:275368 7/20 (35%)
CG12299NP_609448.1 COG5048 <254..413 CDD:227381 45/179 (25%)
C2H2 Zn finger 256..276 CDD:275368 7/28 (25%)
zf-H2C2_2 268..293 CDD:290200 10/24 (42%)
C2H2 Zn finger 284..304 CDD:275368 7/19 (37%)
zf-H2C2_2 296..321 CDD:290200 8/27 (30%)
zf-C2H2_2 312..>387 CDD:289522 21/77 (27%)
C2H2 Zn finger 312..332 CDD:275368 6/19 (32%)
C2H2 Zn finger 340..360 CDD:275368 6/19 (32%)
C2H2 Zn finger 369..389 CDD:275368 4/20 (20%)
C2H2 Zn finger 397..417 CDD:275368 8/20 (40%)
zf-H2C2_2 409..434 CDD:290200 10/28 (36%)
C2H2 Zn finger 425..445 CDD:275368 4/20 (20%)
zf-H2C2_2 437..462 CDD:290200 9/25 (36%)
C2H2 Zn finger 453..473 CDD:275368 6/19 (32%)
zf-H2C2_2 465..490 CDD:290200 9/24 (38%)
C2H2 Zn finger 481..501 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.