DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and CG44002

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_608754.1 Gene:CG44002 / 33535 FlyBaseID:FBgn0264744 Length:345 Species:Drosophila melanogaster


Alignment Length:346 Identity:71/346 - (20%)
Similarity:131/346 - (37%) Gaps:79/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 LPCAICNLLVH--NFTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCE 390
            ||.:|.::::.  .| ::::...|.|.:.|..:......||..|..                  |
  Fly    25 LPVSIAHMIIECTGF-KVEKGDSLPHSICPPCVKDAHNAFTIIKTY------------------E 70

  Fly   391 KSFQNSRHLES---HQQVHMDPAVKLTFSCDLC------SKTFLSKTAIDYHKLNKHVPK----- 441
            :|:|....::.   .:::..|..::|:.|.::.      .|..||:.....::::.....     
  Fly    71 RSYQVFYEVQDTVLEEELSEDVIIELSDSDEVILIDEQEEKVHLSENKAPTNEVSTQEESKTAQS 135

  Fly   442 ---SEFK-FTCSECNKKFLTERKLKNHMSSMHDPE---------------------------STI 475
               ||.| ..|::|:..|.....|:.|:...|..:                           ||.
  Fly   136 DNVSEDKGHICTQCHMSFRRPGLLELHILRHHTTDGPRPMSSTSEHAVKEELRTKARQLSRNSTH 200

  Fly   476 ICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAGEH- 539
            .|..|.|...:|....:||:....:||      ..|:||......:..:|:|:::    ..||. 
  Fly   201 TCRLCNKTFCSKASCVRHQKTHTGEKP------FACEICQKPFADLASVKRHLRT----HTGERP 255

  Fly   540 -RCHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPNCPM 603
             :|..|.....:..|||:|| ..|..||.:||.||:|.|:...:.::|..:||.|..:.|..|..
  Fly   256 FKCLTCQSAFSDGSALRQHI-RIHTGERPYKCDMCDKFFRERSDARKHMMSHTAEKRFKCSQCER 319

  Fly   604 TFFCSANMYKHRQRLHRAQYE 624
            .|.....:.:|.:..|..:.|
  Fly   320 RFRQPKGLRRHVKLCHTDKVE 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 3/22 (14%)
C2H2 Zn finger 360..378 CDD:275368 3/17 (18%)
LIM 361..>400 CDD:295319 6/38 (16%)
C2H2 Zn finger 386..406 CDD:275368 3/22 (14%)
zf-C2H2_8 389..465 CDD:292531 16/93 (17%)
C2H2 Zn finger 417..438 CDD:275368 3/26 (12%)
C2H2 Zn finger 448..465 CDD:275368 4/16 (25%)
C2H2 Zn finger 477..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 511..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 570..590 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..619 CDD:275368 4/20 (20%)
CG44002NP_608754.1 zf-AD 5..78 CDD:285071 13/71 (18%)
C2H2 Zn finger 146..166 CDD:275368 5/19 (26%)
COG5048 <162..302 CDD:227381 35/150 (23%)
C2H2 Zn finger 202..222 CDD:275368 6/19 (32%)
zf-H2C2_2 217..238 CDD:290200 7/26 (27%)
C2H2 Zn finger 230..250 CDD:275368 5/23 (22%)
zf-H2C2_2 242..266 CDD:290200 6/27 (22%)
C2H2 Zn finger 258..278 CDD:275368 7/20 (35%)
zf-H2C2_2 270..293 CDD:290200 13/23 (57%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
C2H2 Zn finger 314..333 CDD:275368 4/18 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.