DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and si:dkeyp-84f3.5

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001313282.1 Gene:si:dkeyp-84f3.5 / 334144 ZFINID:ZDB-GENE-050208-162 Length:580 Species:Danio rerio


Alignment Length:532 Identity:103/532 - (19%)
Similarity:174/532 - (32%) Gaps:157/532 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 DGGSDGFDSDSDFEL---DNGK---QEFAVLPKRTVVRPKKYKKRTKPAEPKVRMSRELLEQRKK 311
            ||.|:|...:...|:   :||.   .:.:||...|.:..|...||..|..     |:|.:...|.
Zfish    48 DGISNGSSVNPSIEVALHENGTLTVVDRSVLSNFTFLFGKPQPKRFCPPP-----SQETIVPSKM 107

  Fly   312 QQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRLTHQVDPGY--MMCCGRKFTQRKVLAEH 374
            .::|         .::..|..|..|......:..|.:. ..::.|:  .:|| :....|:.|..|
Zfish   108 PEKE---------PALYKCDRCGQLFKTSKSLHLHQQY-RALEQGFKCTLCC-KVLNDRESLQNH 161

  Fly   375 VLVHWNPDHFKCSVCEKSFQNSRHLESHQ---------------QVHMDPAVKLTFSCDLCSKTF 424
            :..|.:...:.|..|.|.|.....|.|||               |...:.::..::.|..|...|
Zfish   162 LQNHAHERFYSCGHCGKRFLRQDSLLSHQKQWHGSASSRILSRSQEDQENSMDRSYPCKSCGLRF 226

  Fly   425 LSKTAIDYHKLNKH--VPKSEFKF-------------------------TCSECNKKFLTERKLK 462
            ...:.:..| ||.|  |.||..:.                         .|..|.:.||....|:
Zfish   227 FWLSDLQSH-LNSHSRVNKSPNEVMQDQALGEENRKIDDNSVISQFNEPCCGLCGQNFLNTSDLR 290

  Fly   463 NHMSSMHDPE-----STIICDKCGKQ----MRTKIILKKHQELMHSD-KPRPE--------PELQ 509
            .|....|..|     |:::..|..:|    || .::.|:|::|:..: |.:|:        .:|.
Zfish   291 EHHKVEHPDEIEVKDSSVLPAKAKQQYHGVMR-HMVAKQHKQLLRVNIKGKPKRINRATYTGKLF 354

  Fly   510 QCQICGAWLKGMTGLKQHMKSIHVESAGEHRCHICAKVSPNARALRRHI--YH------------ 560
            .|:.|.......:.|.:||:   ......|.|..|.:..|....:.||:  ||            
Zfish   355 SCKHCHRVFVHSSSLSRHMR---YHKGTLHACVYCGRHFPQRCDVTRHVAMYHASELQSKSQEES 416

  Fly   561 --NHEC-----------------------------------------------ERKFKCTMCEKA 576
              .||.                                               :.|:||..|.:.
Zfish   417 TMEHETGNGEQEPMKESTQTTSDGEQEDLEEENQPSSKSEDLFGSRFKKTFKPKMKYKCKECCRV 481

  Fly   577 FKRPQELKEHTSTHTG---EVLYTCPNCPMTFFCSANMYKHRQRLHRAQYEADKNQPKPPNILKI 638
            |......:.|...|..   .:|.:||.||..|..::.:.:|.:..|:.....|..  |||....|
Zfish   482 FGLLSVFQRHMVHHKRNPYRLLLSCPLCPSRFSFTSALNRHLECHHKRDPGTDVT--KPPETNDI 544

  Fly   639 SRNASTQNKPKQ 650
            :.....::.|.:
Zfish   545 NSQVQQEDSPTE 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 5/17 (29%)
C2H2 Zn finger 330..351 CDD:275368 4/20 (20%)
C2H2 Zn finger 360..378 CDD:275368 5/17 (29%)
LIM 361..>400 CDD:295319 9/38 (24%)
C2H2 Zn finger 386..406 CDD:275368 9/34 (26%)
zf-C2H2_8 389..465 CDD:292531 23/117 (20%)
C2H2 Zn finger 417..438 CDD:275368 6/20 (30%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 7/24 (29%)
C2H2 Zn finger 511..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 541..562 CDD:275368 7/36 (19%)
C2H2 Zn finger 570..590 CDD:275368 4/19 (21%)
C2H2 Zn finger 598..619 CDD:275368 6/20 (30%)
si:dkeyp-84f3.5NP_001313282.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.