DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and CG2889

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001245615.1 Gene:CG2889 / 31977 FlyBaseID:FBgn0030206 Length:581 Species:Drosophila melanogaster


Alignment Length:691 Identity:163/691 - (23%)
Similarity:262/691 - (37%) Gaps:164/691 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLCM-CEYPAMMGDYIDVHSARGDQLEVTTIVN---QHFPVQISKES--DERICGRCWKIVSDF 65
            |.||: |..|   |..:.:... .|.|..|.:|.   :...::|..:.  ...:|..|.:.:.||
  Fly     3 CRLCLRCLSP---GSAVFLFET-DDTLAETRLVKMIAKFLQLEILPDDGISTSVCTECCEHLEDF 63

  Fly    66 HTLHEFVSAAQSSLQETKVAL----------------------------MEDDPLTQETTSFPEI 102
            :...:.|...|.||::..:.:                            |::.||.....|....
  Fly    64 NGFWQLVEQKQCSLKKEFLTVDVDCAAMKWTGGVDVDVNIDELPLAAGDMDEKPLDLHNLSLLGS 128

  Fly   103 IKLATQEEEGVTEPQELGGRNFFYPEIKIEEHELDTLPRIEILERSANTQENQDQLEGAARRLRK 167
            :.....:...|.||        ...::..||.| |..|.::..:......|.|.:.|.       
  Fly   129 VLDVNVDSVEVREP--------IKEQLPCEEEE-DEKPCLQASDSEPEVTEGQPESES------- 177

  Fly   168 RLKAEDGSSVDKDKDEDGVEETAEPAPPKKRRGRPRKSDAAVAPPQKPKEDIQLDLKAEELDEFV 232
                      |...||..|...::..|.:|...|..|....::..|             ||.:.:
  Fly   178 ----------DSSDDEPLVRLKSKMKPKRKTSARSSKDQGPISLQQ-------------ELADLL 219

  Fly   233 DEETDPDFSCLVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVRPKKYKKRTKPAEP 297
                               ||||                               |.::|..|.:.
  Fly   220 -------------------DDGG-------------------------------KRRRRKAPDQR 234

  Fly   298 KVRMSRE-----LLEQRKK------QQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRLTH 351
            ....|:|     :||::.|      ..:.|:..||.:.::  .|.:|.......:|::.|....|
  Fly   235 TTTESQESELQAVLERKPKGCSRAQLAKSYEKAIASYMSA--SCDLCEFSAPYLSELKTHFLEVH 297

  Fly   352 QVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESH-QQVHMDPA---VK 412
            |.: .|:.|||:.||:...|.:|:..|.||..|.|::|:||..:..:|.:| :.||...|   ..
  Fly   298 QRE-YYIKCCGKVFTRASKLMDHIRKHINPKLFTCTICKKSLNSQDYLATHIETVHNKVAQIGKV 361

  Fly   413 LTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPESTIIC 477
            |.|.|..|.:||.|:..:..| |.|| ...:.:.||..|.|.|....:|:.|:.|:|:.....:|
  Fly   362 LKFPCPKCERTFSSERRMANH-LAKH-DTDQLEHTCEICCKSFANVHRLRRHIQSIHEDLHRHVC 424

  Fly   478 DKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAGEHRCH 542
            |.|||:.:.|...::|. |.|.....|..|   |.||..|||....|:.|.   ....:.:..|.
  Fly   425 DICGKKFKFKPSFERHL-LEHQGVVAPAVE---CPICRVWLKNEHSLRLHR---FTHDSTDTVCP 482

  Fly   543 ICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPNCPMTFFC 607
            .|.|...:..|||.|:.:.|:.....:||.|||.||:.:.|.||.:.|||..||.||:||.....
  Fly   483 HCGKTCTSRTALRGHVKYAHKLTTNLQCTFCEKTFKQQRNLDEHMAIHTGLQLYNCPHCPKECRS 547

  Fly   608 SANMYKHRQRLHRAQYEADKNQPKPPNILKISRNASTQNKP 648
            .:|||.|.::.|..::..          .|::|:.:.|.||
  Fly   548 RSNMYVHIKQRHADEWLR----------AKMARSHNPQFKP 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071 19/79 (24%)
FYDLN_acid <191..268 CDD:302856 11/76 (14%)
C2H2 Zn finger 330..351 CDD:275368 4/20 (20%)
C2H2 Zn finger 360..378 CDD:275368 7/17 (41%)
LIM 361..>400 CDD:295319 14/38 (37%)
C2H2 Zn finger 386..406 CDD:275368 6/20 (30%)
zf-C2H2_8 389..465 CDD:292531 25/79 (32%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 8/20 (40%)
C2H2 Zn finger 511..532 CDD:275368 8/20 (40%)
C2H2 Zn finger 541..562 CDD:275368 7/20 (35%)
C2H2 Zn finger 570..590 CDD:275368 10/19 (53%)
C2H2 Zn finger 598..619 CDD:275368 8/20 (40%)
CG2889NP_001245615.1 zf-AD 2..79 CDD:285071 19/79 (24%)
C2H2 Zn finger 276..297 CDD:275368 4/20 (20%)
C2H2 Zn finger 306..323 CDD:275368 6/16 (38%)
C2H2 Zn finger 331..352 CDD:275368 6/20 (30%)
C2H2 Zn finger 366..386 CDD:275368 7/20 (35%)
C2H2 Zn finger 395..416 CDD:275368 7/20 (35%)
C2H2 Zn finger 424..444 CDD:275368 8/20 (40%)
C2H2 Zn finger 481..502 CDD:275368 7/20 (35%)
C2H2 Zn finger 510..530 CDD:275368 10/19 (53%)
C2H2 Zn finger 538..556 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134721
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000909
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.