DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and Zfp541

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_001100928.2	Gene:	Zfp541 / 308108	RGDID:	1310756	Length:	1301	Species:	Rattus norvegicus

Alignment Length:	114	Identity:	33/114 - (28%)
Similarity:	47/114 - (41%)	Gaps:	20/114 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   541 CHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTC--PNCPM 603
            |.:|.||..:|.:|.:| |..|..|||..|.:|.|||||...|..|..||.....:.|  ..|..
  Rat   142 CSLCGKVFSSASSLSKH-YLTHSQERKHVCKVCSKAFKRQDHLTGHMLTHQKTKPFVCIEQGCSK 205

  Fly   604 TFFCSANMYKHRQRLH------RAQYEADK-----------NQPKPPNI 635
            ::....::.:|.:..|      .|..|.:.           |||.|..:
  Rat   206 SYCDYRSLRRHYEVQHGVCILKEAPPEEESYGDPTHNHDVANQPPPSGL 254

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368
		C2H2 Zn finger	541..562	CDD:275368	8/20 (40%)
		C2H2 Zn finger	570..590	CDD:275368	9/19 (47%)
		C2H2 Zn finger	598..619	CDD:275368	3/22 (14%)
Zfp541	NP_001100928.2	COG5236	<80..>227	CDD:227561	27/85 (32%)
		C2H2 Zn finger	142..162	CDD:275368	8/20 (40%)
		zf-C2H2	168..190	CDD:395048	9/21 (43%)
		C2H2 Zn finger	170..190	CDD:275368	9/19 (47%)
		C2H2 Zn finger	198..216	CDD:275368	2/17 (12%)
		PHA03247	<244..672	CDD:223021	4/11 (36%)
		ELM2	1003..1058	CDD:396160
		SANT	1113..1156	CDD:419695
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910