DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and Zfp407

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_008770443.2 Gene:Zfp407 / 307213 RGDID:1310645 Length:2255 Species:Rattus norvegicus


Alignment Length:629 Identity:146/629 - (23%)
Similarity:220/629 - (34%) Gaps:179/629 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 CEYPAMMGDYIDVHSARGDQLEVTTIV--NQHFPVQISKESDERICGRCWKIVSDFHTLHEFVSA 74
            ||..:  .|..||.:  ...||...|:  :||.|..|.:|......|                :|
  Rat  1277 CEQTS--EDLKDVQA--NSNLESKEILMNSQHEPEVILEEDAPASIG----------------TA 1321

  Fly    75 AQSSLQETKVALMEDDPLTQETTSF----PEIIKLATQEEEGVTEPQE----LGGRNFFYPEIKI 131
            ..:...||.:::   |...|...||    ..||::.|::.|.|.:|:|    .||        |:
  Rat  1322 ENNDAYETIISI---DDKGQTMYSFGRFDSSIIRIKTEDGELVEQPEEGLMVTGG--------KV 1375

  Fly   132 EEHELDTLPRIEILERSANTQENQDQLEGAARRLRKRLKAEDGSSVDKDK----DE-----DGVE 187
            .|     ||                 |:..|:.|:|  |..:|||..:..    |:     ||:.
  Rat  1376 SE-----LP-----------------LKDCAQGLKK--KKVEGSSFGESTRIRCDDCGFLADGLS 1416

  Fly   188 ----ETAEPAPPKKRR-----------------------GRPRKSDAAVAPPQKPKEDIQLDLKA 225
                ..|...|.|::.                       |..|...|:|                
  Rat  1417 GLNVHIAMKHPTKEKHFHCLLCGKSFYTESNLHQHLASAGHMRNEQASV---------------- 1465

  Fly   226 EELDEFVDEETDPDFSCLVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVRPKKYKK 290
            |||     .|....|.|:          ..::.|||:.:..|....|...:|  |.|   .||  
  Rat  1466 EEL-----PEGGATFKCV----------KCTEPFDSEQNLFLHIKGQHEELL--REV---NKY-- 1508

  Fly   291 RTKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQ--RHHRLTHQV 353
                       ..|..||..:::||....:.|:         |..:..:...|.  .|.|.....
  Rat  1509 -----------IVEDTEQINREREENQGNVCKY---------CGKMCRSSNSMAFLAHIRTHTGS 1553

  Fly   354 DPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESH--QQVHMDPAVKLTFS 416
            .|.....|.....|......||..|.....:||.||..:|...:||.:|  .:..:....:..|:
  Rat  1554 KPFKCKICHFATAQLGDARNHVKRHLGMREYKCHVCGVAFVMKKHLNTHLLGKHGVGTPKERKFT 1618

  Fly   417 CDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCG 481
            |.||.::|..|.|::.| :..|..:..||.|...|:..|||...:|:|..: |..|.:.:||.||
  Rat  1619 CHLCDRSFTEKWALNNH-VKLHTGEKPFKCTWPTCHYSFLTASAMKDHYRT-HTGEKSFLCDLCG 1681

  Fly   482 KQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAGE--HRCHIC 544
            ....|:..|.||:.....:||      .:|..|.......:.|.:| |.:|   .||  :||..|
  Rat  1682 FAGGTRHALTKHRRQHTGEKP------FKCDECNFASTTQSHLTRH-KRVH---TGEKPYRCPWC 1736

  Fly   545 AKVSPNARALRRHIYH--NHECERKFKCTMCEKAFKRPQELKEH 586
            ...|..|..:|:||.|  .||..:.:.|..|:.....|.|.:.|
  Rat  1737 DYRSNCAENIRKHILHTGKHEGVKMYNCPKCDYGTNVPVEFRNH 1780

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071 15/70 (21%)
FYDLN_acid <191..268 CDD:302856 15/99 (15%)
C2H2 Zn finger 330..351 CDD:275368 4/22 (18%)
C2H2 Zn finger 360..378 CDD:275368 4/17 (24%)
LIM 361..>400 CDD:295319 11/38 (29%)
C2H2 Zn finger 386..406 CDD:275368 7/21 (33%)
zf-C2H2_8 389..465 CDD:292531 22/77 (29%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 8/20 (40%)
C2H2 Zn finger 511..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 541..562 CDD:275368 8/22 (36%)
C2H2 Zn finger 570..590 CDD:275368 5/17 (29%)
C2H2 Zn finger 598..619 CDD:275368
Zfp407XP_008770443.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.