DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and REPIN1

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001374966.1 Gene:REPIN1 / 29803 HGNCID:17922 Length:626 Species:Homo sapiens


Alignment Length:339 Identity:80/339 - (23%)
Similarity:121/339 - (35%) Gaps:93/339 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 CAICNLLVHNFTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQ 394
            ||.|.....:...:..|.|:.....|.....||::||.:..|..|..:|.....:.|..|.:.|:
Human   297 CACCGKRFRHKPNLIAHRRVHTGERPHQCPECGKRFTNKPYLTSHRRIHTGEKPYPCKECGRRFR 361

  Fly   395 NSRHLESHQQVHM----------------------------DPAVKL------------------ 413
            :..:|.||.::|.                            .|||.|                  
Human   362 HKPNLLSHSKIHKRSEGSAQAAPGPGSPQLPAGPQESAAEPTPAVPLKPAQEPPPGAPPEHPQDP 426

  Fly   414 ------TFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPE 472
                  .:|||.|.::|..:..:..|: .:|.  .|..|||:||.|.|..:..|..| |.:|..|
Human   427 IEAPPSLYSCDDCGRSFRLERFLRAHQ-RQHT--GERPFTCAECGKNFGKKTHLVAH-SRVHSGE 487

  Fly   473 STIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAG 537
            ....|::||::......|..|:.....|:|      ..|..||                   .|.
Human   488 RPFACEECGRRFSQGSHLAAHRRDHAPDRP------FVCPDCG-------------------KAF 527

  Fly   538 EHRCHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPNCP 602
            .|:.::.|         .|.|   |..|:.:.|..|.|||.:...|..|...||||..|.||:|.
Human   528 RHKPYLAA---------HRRI---HTGEKPYVCPDCGKAFSQKSNLVSHRRIHTGERPYACPDCD 580

  Fly   603 MTFFCSANMYKHRQ 616
            .:|...:|:..||:
Human   581 RSFSQKSNLITHRK 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 5/20 (25%)
C2H2 Zn finger 360..378 CDD:275368 6/17 (35%)
LIM 361..>400 CDD:295319 10/38 (26%)
C2H2 Zn finger 386..406 CDD:275368 6/19 (32%)
zf-C2H2_8 389..465 CDD:292531 26/127 (20%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 6/16 (38%)
C2H2 Zn finger 477..498 CDD:275368 5/20 (25%)
C2H2 Zn finger 511..532 CDD:275368 3/20 (15%)
C2H2 Zn finger 541..562 CDD:275368 3/20 (15%)
C2H2 Zn finger 570..590 CDD:275368 7/19 (37%)
C2H2 Zn finger 598..619 CDD:275368 7/19 (37%)
REPIN1NP_001374966.1 C2H2 Zn finger 118..138 CDD:275368
C2H2 Zn finger 146..166 CDD:275368
C2H2 Zn finger 177..197 CDD:275368
COG5048 <197..371 CDD:227381 19/73 (26%)
C2H2 Zn finger 206..227 CDD:275368
C2H2 Zn finger 238..258 CDD:275368
COG5048 292..599 CDD:227381 80/339 (24%)
C2H2 Zn finger 297..317 CDD:275368 5/19 (26%)
C2H2 Zn finger 325..345 CDD:275368 6/19 (32%)
C2H2 Zn finger 353..373 CDD:275368 6/19 (32%)
C2H2 Zn finger 436..456 CDD:275368 5/20 (25%)
C2H2 Zn finger 464..484 CDD:275368 8/20 (40%)
C2H2 Zn finger 492..512 CDD:275368 5/19 (26%)
C2H2 Zn finger 520..540 CDD:275368 8/50 (16%)
C2H2 Zn finger 548..568 CDD:275368 7/19 (37%)
C2H2 Zn finger 576..596 CDD:275368 7/19 (37%)
C2H2 Zn finger 604..624 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.