DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZBTB7C

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_016881094.1 Gene:ZBTB7C / 201501 HGNCID:31700 Length:668 Species:Homo sapiens


Alignment Length:398 Identity:78/398 - (19%)
Similarity:132/398 - (33%) Gaps:150/398 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 IEILERSANTQENQDQLEGAARRLRKRLKAEDGSSVDKDKDEDGVEETAEPAPPKKRRGRPRKSD 206
            :||:|...:..|..|             |.:|....|.|.:||..||..|               
Human   173 LEIMEPGGDGGEEDD-------------KEDDDDDEDDDDEEDEEEEEEE--------------- 209

  Fly   207 AAVAPPQKPKEDIQLDLKAEELDEFVDEET--DP-DFSCL----------------VPSDNSSED 252
                     :||     ..::.::|.|:|.  || |.||.                .|.|.....
Human   210 ---------EED-----DDDDTEDFADQENLPDPQDISCHQSPSKTDHLTEKAYSDTPRDFPDSF 260

  Fly   253 DGGSDG-FDSDSDFELDNGKQE---------------------------------FAVLPKR--- 280
            ..||.| .....||.:::..:|                                 ||.||::   
Human   261 QAGSPGHLGVIRDFSIESLLRENLYPKANIPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMD 325

  Fly   281 -----TVVRPKKYKKRTK---PAEPKVRMSRELLEQR-----------KKQQEEY----DVIIAK 322
                 .|::.:|.|:..|   |..|......:..:..           .|.:.:|    :.:.|.
Human   326 SGPLDLVIKNRKIKEEEKEELPPPPPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSAT 390

  Fly   323 FFTSVLP-----------------CAICNLLVHNFTEMQRHHRLTHQVDPGYMMC--CGRKFTQR 368
            ....:.|                 |.||:.::....::.||.| ||..:..| ||  |..:||::
Human   391 HLGGLFPPWPLVEERKLKPKASQQCPICHKVIMGAGKLPRHMR-THTGEKPY-MCTICEVRFTRQ 453

  Fly   369 KVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYH 433
            ..|..|:..|.....:.|..|...|.::..|::|.::|  ..|: .:.|:.|.|:|   |..|: 
Human   454 DKLKIHMRKHTGERPYLCIHCNAKFVHNYDLKNHMRIH--TGVR-PYQCEFCYKSF---TRSDH- 511

  Fly   434 KLNKHVPK 441
             |::|:.:
Human   512 -LHRHIKR 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 18/96 (19%)
C2H2 Zn finger 330..351 CDD:275368 6/20 (30%)
C2H2 Zn finger 360..378 CDD:275368 6/19 (32%)
LIM 361..>400 CDD:295319 9/38 (24%)
C2H2 Zn finger 386..406 CDD:275368 5/19 (26%)
zf-C2H2_8 389..465 CDD:292531 14/53 (26%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..465 CDD:275368
C2H2 Zn finger 477..498 CDD:275368
C2H2 Zn finger 511..532 CDD:275368
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
ZBTB7CXP_016881094.1 BTB 73..176 CDD:279045 1/2 (50%)
BTB 84..177 CDD:197585 2/3 (67%)
C2H2 Zn finger 415..435 CDD:275368 6/20 (30%)
zf-H2C2_2 430..452 CDD:290200 10/23 (43%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)
zf-H2C2_2 456..480 CDD:290200 6/23 (26%)
C2H2 Zn finger 471..491 CDD:275368 5/19 (26%)
zf-H2C2_2 483..508 CDD:290200 8/30 (27%)
C2H2 Zn finger 499..517 CDD:275368 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.