DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and T07D10.3

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_493194.2 Gene:T07D10.3 / 188228 WormBaseID:WBGene00011583 Length:377 Species:Caenorhabditis elegans


Alignment Length:298 Identity:64/298 - (21%)
Similarity:121/298 - (40%) Gaps:70/298 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 VVRPKKYKKRTKPAEPKVRMSREL--LEQRKKQQEEYDVII-AKF------FTSVLPC--AICNL 335
            ||.|.: ::.|.|...:: :|.||  |..:....:.|:..: .||      |..|:||  :.|:|
 Worm    35 VVEPLR-QRETCPKCHQI-LSSELSRLWHQFVHMDAYNGFLDGKFQIQLPDFEFVIPCPFSTCSL 97

  Fly   336 LVHNFTEMQRHHRLTHQVDPGYMMCCGRKFTQRKVLAEHV-------LVHWNPD-HFK-----CS 387
            |..:..:.:.|:.|.||  ...:.|||.:|:..|...||:       ...|:.. ||.     |:
 Worm    98 LFLDLIDARFHYLLEHQ--SCQLFCCGVRFSDYKTALEHLQGTGSVETEAWDQQKHFLKPVYICN 160

  Fly   388 VCEKSFQNSR----HLESHQQVHMDPAVKLTFSC-DLCSKTFLSK-----------TAIDYHKLN 436
            .|.:::.:..    ||.....:..||..|..|.. :.|.:.|..:           ..::|....
 Worm   161 CCNRTWSSRNEYVAHLHGRDHMCPDPVCKYIFETNEKCIRHFFEQHYKHLFLDSRHLLLNYKYFL 225

  Fly   437 KHVPKSEFK----FTCSECNKKFLTERKLKNHMSSMH----DPE---STIICDKCGKQ------- 483
            ::..|.|.:    :.|:.|.::|...:..::|::|.:    |.:   ..|.| |||.|       
 Worm   226 RYQEKQEERAYGLYVCTTCQRRFRDNKGFQSHVASQNCEFFDRKFFVQVIAC-KCGHQFKYCYYQ 289

  Fly   484 ----MRTKIILKKHQELMHSDKPRPEPELQQCQICGAW 517
                :|...:|::..|  |.::..|...:.: .:|..:
 Worm   290 RDVLLRNLPVLREAME--HVEREAPFNNMPE-DVCNIY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 6/22 (27%)
C2H2 Zn finger 360..378 CDD:275368 7/24 (29%)
LIM 361..>400 CDD:295319 12/55 (22%)
C2H2 Zn finger 386..406 CDD:275368 4/23 (17%)
zf-C2H2_8 389..465 CDD:292531 15/95 (16%)
C2H2 Zn finger 417..438 CDD:275368 3/32 (9%)
C2H2 Zn finger 448..465 CDD:275368 3/16 (19%)
C2H2 Zn finger 477..498 CDD:275368 8/31 (26%)
C2H2 Zn finger 511..532 CDD:275368 1/7 (14%)
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
T07D10.3NP_493194.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.