DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZNF679

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_699194.2 Gene:ZNF679 / 168417 HGNCID:28650 Length:411 Species:Homo sapiens


Alignment Length:333 Identity:85/333 - (25%)
Similarity:131/333 - (39%) Gaps:48/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCAI------------------------CN 334
            |.|..::.|.:.:..|:..:..:|.:..|...|:..|.:                        |.
Human    98 PPELGIKDSLQKVIPRRYGKSGHDNLQVKTCKSMGECEVQKGGCNEVNQCLSTTQNKIFQTHKCV 162

  Fly   335 LLVHNFTEMQRHHRLTHQVDPGYMMC--CGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSR 397
            .:...|:...||.  |......:..|  .|:.|.....|.:|.::|...:.::|..|.|.|..|.
Human   163 KVFGKFSNSNRHK--TRHTGKKHFKCKKYGKSFCMVSQLHQHQIIHTRENSYQCEECGKPFNCSS 225

  Fly   398 HLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLK 462
            .|..|:::|..   :..:.|:.|.|.|...:.:..|   :.:...|..:||.||.:.|.....|.
Human   226 TLSKHKRIHTG---EKPYRCEECGKAFTWSSTLTKH---RRIHTGEKPYTCEECGQAFSRSSTLA 284

  Fly   463 NHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQH 527
            || ..:|..|....|::|||.......|..|:.:...:||      ..|:.||......:.||:|
Human   285 NH-KRIHTGEKPYTCEECGKAFSLSSSLTYHKRIHTGEKP------YTCEECGKAFNCSSTLKKH 342

  Fly   528 MKSIHVESAGE--HRCHICAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTH 590
             |.||   .||  ::|..|.|....:..|..| ...|..|..:||..|:||||....|..|.|.|
Human   343 -KIIH---TGEKPYKCKECGKAFAFSSTLNTH-KRIHTGEEPYKCEECDKAFKWSSSLANHKSMH 402

  Fly   591 TGEVLYTC 598
            |||..|.|
Human   403 TGEKPYKC 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 5/44 (11%)
C2H2 Zn finger 360..378 CDD:275368 5/19 (26%)
LIM 361..>400 CDD:295319 10/38 (26%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
zf-C2H2_8 389..465 CDD:292531 20/75 (27%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 6/16 (38%)
C2H2 Zn finger 477..498 CDD:275368 6/20 (30%)
C2H2 Zn finger 511..532 CDD:275368 7/20 (35%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 570..590 CDD:275368 9/19 (47%)
C2H2 Zn finger 598..619 CDD:275368 1/1 (100%)
ZNF679NP_699194.2 KRAB 16..76 CDD:214630
KRAB 16..55 CDD:279668
C2H2 Zn finger 159..178 CDD:275368 5/20 (25%)
C2H2 Zn finger 186..206 CDD:275368 5/19 (26%)
C2H2 Zn finger 214..234 CDD:275368 7/19 (37%)
zf-H2C2_2 227..250 CDD:290200 6/25 (24%)
COG5048 <238..401 CDD:227381 51/177 (29%)
C2H2 Zn finger 242..262 CDD:275368 5/22 (23%)
zf-H2C2_2 255..279 CDD:290200 7/26 (27%)
C2H2 Zn finger 270..290 CDD:275368 7/20 (35%)
zf-H2C2_2 283..306 CDD:290200 9/23 (39%)
C2H2 Zn finger 298..318 CDD:275368 6/19 (32%)
zf-H2C2_2 310..335 CDD:290200 7/30 (23%)
C2H2 Zn finger 326..346 CDD:275368 7/20 (35%)
zf-H2C2_2 339..362 CDD:290200 11/26 (42%)
C2H2 Zn finger 354..374 CDD:275368 5/20 (25%)
zf-H2C2_2 367..390 CDD:290200 9/23 (39%)
C2H2 Zn finger 382..402 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.