DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and Klf4

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_034767.2	Gene:	Klf4 / 16600	MGIID:	1342287	Length:	483	Species:	Mus musculus

Alignment Length:	144	Identity:	34/144 - (23%)
Similarity:	54/144 - (37%)	Gaps:	30/144 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   483 QMRTKIILKKHQELMH-----SDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAGEHRCH 542
            ||::::....:||||.     .::|:|                    |:..:|...:....|.|.
Mouse   359 QMQSQVPSLHYQELMPPGSCLPEEPKP--------------------KRGRRSWPRKRTATHTCD 403

  Fly   543 I--CAKVSPNARALRRHIYHNHECERKFKCTM--CEKAFKRPQELKEHTSTHTGEVLYTCPNCPM 603
            .  |.|....:..|:.|: ..|..|:.:.|..  |...|.|..||..|...|||...:.|..|..
Mouse   404 YAGCGKTYTKSSHLKAHL-RTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDR 467

  Fly   604 TFFCSANMYKHRQR 617
            .|..|.::..|.:|
Mouse   468 AFSRSDHLALHMKR 481

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368	5/14 (36%)
		C2H2 Zn finger	511..532	CDD:275368	2/20 (10%)
		C2H2 Zn finger	541..562	CDD:275368	5/22 (23%)
		C2H2 Zn finger	570..590	CDD:275368	7/21 (33%)
		C2H2 Zn finger	598..619	CDD:275368	6/20 (30%)
Klf4	NP_034767.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	22..42
		9aaTAD. /evidence=ECO:0000250\|UniProtKB:O43474	99..107
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	294..395		10/55 (18%)
		Interaction with ZNF296. /evidence=ECO:0000269\|PubMed:24161396	386..483		26/97 (27%)
		COG5048	<395..478	CDD:227381	22/83 (27%)
		zf-C2H2	400..424	CDD:278523	6/24 (25%)
		C2H2 Zn finger	402..424	CDD:275368	5/22 (23%)
		C2H2 Zn finger	432..454	CDD:275368	7/21 (33%)
		Interaction with target DNA	443..474		11/30 (37%)
		zf-H2C2_2	446..471	CDD:290200	9/24 (38%)
		C2H2 Zn finger	462..482	CDD:275368	6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910