DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and Klf2

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	NP_032478.2	Gene:	Klf2 / 16598	MGIID:	1342772	Length:	354	Species:	Mus musculus

Alignment Length:	123	Identity:	35/123 - (28%)
Similarity:	52/123 - (42%)	Gaps:	18/123 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   292 TKPAEPKVRMSRELLEQR-KKQQEEYDVIIAKFFTSVLPCAI--CNLLVHNFTEMQRHHRLTHQV 353
            |.|:.|     .||||.: |:.:..:....|...|    |:.  |.......:.::.|.| ||..
Mouse   243 TPPSSP-----LELLEAKPKRGRRSWPRKRAATHT----CSYTNCGKTYTKSSHLKAHLR-THTG 297

  Fly   354 DPGYMMC----CGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQVHM 407
            :..| .|    ||.||.:...|..|...|.....|:|.:|:::|..|.||..|.:.||
Mouse   298 EKPY-HCNWEGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALHMKRHM 354

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368	4/22 (18%)
		C2H2 Zn finger	360..378	CDD:275368	7/21 (33%)
		LIM	361..>400	CDD:295319	13/38 (34%)
		C2H2 Zn finger	386..406	CDD:275368	7/19 (37%)
		zf-C2H2_8	389..465	CDD:292531	8/19 (42%)
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368
		C2H2 Zn finger	511..532	CDD:275368
		C2H2 Zn finger	541..562	CDD:275368
		C2H2 Zn finger	570..590	CDD:275368
		C2H2 Zn finger	598..619	CDD:275368
Klf2	NP_032478.2	9aaTAD. /evidence=ECO:0000250\|UniProtKB:Q9Y5W3	42..50
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	52..111
		Interaction with WWP1	110..267		8/28 (29%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	145..208
		zf-C2H2	271..295	CDD:278523	5/28 (18%)
		C2H2 Zn finger	273..295	CDD:275368	4/22 (18%)
		COG5048	<276..>353	CDD:227381	22/78 (28%)
		zf-C2H2	301..325	CDD:278523	8/24 (33%)
		C2H2 Zn finger	303..325	CDD:275368	7/21 (33%)
		zf-H2C2_2	317..342	CDD:290200	7/24 (29%)
		C2H2 Zn finger	333..353	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910