DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and ZNF540

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:NP_001165696.1 Gene:ZNF540 / 163255 HGNCID:25331 Length:660 Species:Homo sapiens


Alignment Length:334 Identity:99/334 - (29%)
Similarity:136/334 - (40%) Gaps:44/334 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 KFFTSVLP--CAICN---LLVHNFTEMQRHHRLTHQVDPGYMMC--CGRKFTQRKVLAEHVLVHW 379
            |..|.|.|  |..|.   .|....||    ||.||.....| .|  ||:.|..|..|..|..:|.
Human   347 KIHTGVKPYECKECGKTFRLSFYLTE----HRRTHAGKKPY-ECKECGKSFNVRGQLNRHKTIHT 406

  Fly   380 NPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSKTFLSKTAIDYH-KLNKHVPKSE 443
            ....|.|.||||:|..|..|..|.::|..   :..:.|..|.|.|:.::.:..| :|:..|...|
Human   407 GIKPFACKVCEKAFSYSGDLRVHSRIHTG---EKPYECKECGKAFMLRSVLTEHQRLHTGVKPYE 468

  Fly   444 FKFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPEL 508
                |.||.|.|....::..| ..:|.......|.:|||..|....|.:||.:...:||      
Human   469 ----CKECGKTFRVRSQISLH-KKIHTDVKPYKCVRCGKTFRFGFYLTEHQRIHTGEKP------ 522

  Fly   509 QQCQICGAWLKGMTGLKQHMKSIHVESAGEHRCHICAKVSPNARALRRHIYHNHECERKFKCTMC 573
            .:|:.||........||:|:| || .....:.|..|.|..........| ...|...:.:||..|
Human   523 YKCKECGKAFIRRGNLKEHLK-IH-SGLKPYDCKECGKSFSRRGQFTEH-QKIHTGVKPYKCKEC 584

  Fly   574 EKAFKRPQELKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQRLHRAQ--YEADKNQPKPPNIL 636
            .|||.|..:|:.|...||||..|.|..|...|..::::.:| ||:|..:  ||.           
Human   585 GKAFSRSVDLRIHQRIHTGEKPYECKQCGKAFRLNSHLTEH-QRIHTGEKPYEC----------- 637

  Fly   637 KISRNASTQ 645
            |:.|.|..|
Human   638 KVCRKAFRQ 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 7/23 (30%)
C2H2 Zn finger 360..378 CDD:275368 7/19 (37%)
LIM 361..>400 CDD:295319 15/38 (39%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
zf-C2H2_8 389..465 CDD:292531 21/76 (28%)
C2H2 Zn finger 417..438 CDD:275368 6/21 (29%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 8/20 (40%)
C2H2 Zn finger 511..532 CDD:275368 7/20 (35%)
C2H2 Zn finger 541..562 CDD:275368 4/20 (20%)
C2H2 Zn finger 570..590 CDD:275368 8/19 (42%)
C2H2 Zn finger 598..619 CDD:275368 6/20 (30%)
ZNF540NP_001165696.1 KRAB 6..66 CDD:214630
C2H2 Zn finger 189..209 CDD:275368
C2H2 Zn finger 217..237 CDD:275368
COG5048 241..620 CDD:227381 89/294 (30%)
C2H2 Zn finger 245..265 CDD:275368
C2H2 Zn finger 273..293 CDD:275368
C2H2 Zn finger 301..321 CDD:275368
C2H2 Zn finger 329..349 CDD:275368 1/1 (100%)
C2H2 Zn finger 357..377 CDD:275368 7/23 (30%)
C2H2 Zn finger 385..405 CDD:275368 7/19 (37%)
C2H2 Zn finger 413..433 CDD:275368 9/19 (47%)
C2H2 Zn finger 441..461 CDD:275368 5/19 (26%)
C2H2 Zn finger 469..489 CDD:275368 6/20 (30%)
C2H2 Zn finger 497..517 CDD:275368 8/19 (42%)
C2H2 Zn finger 525..545 CDD:275368 7/20 (35%)
C2H2 Zn finger 553..573 CDD:275368 4/20 (20%)
C2H2 Zn finger 581..601 CDD:275368 8/19 (42%)
C2H2 Zn finger 609..629 CDD:275368 6/20 (30%)
zf-H2C2_2 621..646 CDD:316026 9/36 (25%)
C2H2 Zn finger 637..657 CDD:275368 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.