DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and AgaP_AGAP001073

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_003437204.1 Gene:AgaP_AGAP001073 / 1278674 VectorBaseID:AGAP001073 Length:576 Species:Anopheles gambiae


Alignment Length:503 Identity:85/503 - (16%)
Similarity:155/503 - (30%) Gaps:178/503 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DQLEVT-----TIVNQHFPVQISKESDERICGRCWKIVSDFHTLHEFVSAAQSSLQETKVALMED 89
            |.|.:|     |||:|...||...::...|.....|     :|..|..|.|.||.....:|..:.
Mosquito   153 DSLYLTLPSNSTIVHQPKLVQAQIQTTPIITKPLIK-----NTPTEMPSLAASSTLAVPIAQQQQ 212

  Fly    90 DPLTQETTSFPEIIKLATQEEEGVTEPQELGGRNFFYPEIKIEEHELDTLPRIEILERSANTQEN 154
                      |.|.|:..|......:||::        ::::::.:              .||.:
Mosquito   213 ----------PAIAKIQVQASSQSQQPQQV--------QVQVQQVQ--------------QTQTH 245

  Fly   155 QDQLEGAARRLRKRLKAEDGSSVDKDKDEDGVEETAEPAPPKKRRGRPRKSDAAVAPPQKPKEDI 219
            |.|            :|....:..:.:....::|..|                .|..|:|.|   
Mosquito   246 QTQ------------QATTSQTQSQSQQATTLQEVVE----------------NVVLPRKKK--- 279

  Fly   220 QLDLKAEELDEFVDEETDPDFSCLVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVR 284
               :|.:::.......:.|..|.:..:..::...|.::.:::|:                     
Mosquito   280 ---VKGQQIIASQSNTSIPSGSTVTVTTTTTGQSGDNEMYETDT--------------------- 320

  Fly   285 PKKYKKRTKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRL 349
               |...||.|......:.:.:|..:.......:.|.:|.:...|....|               
Mosquito   321 ---YTITTKDAREDHEQAEQYVESGQSSGTTLKMEIPEFISVGEPINTGN--------------- 367

  Fly   350 THQVDPGYMMCCGRKFTQRKVLAEHVLV---------HWNP---------DHFKCSVCEKSFQNS 396
              ..:..|:...|.       |::||.:         |:..         |.|..|:.:||...:
Mosquito   368 --GTNNTYLQVTGS-------LSQHVTIIVFENEFKTHFKQYRYLYSSSYDIFLSSLLQKSTYEA 423

  Fly   397 R---------HLESHQQVHMDPAVKL------------TFS--------------CDLCSKTFLS 426
            .         .|.|:....:.||:.|            |.|              |..|.:||.|
Mosquito   424 EARENYIIIGSLRSYPATWLLPALMLLTRGHHRVLSIVTVSLQKIEIVSDEKLHKCPECRRTFCS 488

  Fly   427 KTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPEST 474
            ..|:..|:..||....: .:.|:.|..:|.|:..|..|.|..|..::|
Mosquito   489 MNAMKRHRQAKHFALQD-SYVCAMCEARFKTKWSLSTHKSKYHRGQTT 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071 17/55 (31%)
FYDLN_acid <191..268 CDD:302856 10/76 (13%)
C2H2 Zn finger 330..351 CDD:275368 1/20 (5%)
C2H2 Zn finger 360..378 CDD:275368 4/26 (15%)
LIM 361..>400 CDD:295319 10/65 (15%)
C2H2 Zn finger 386..406 CDD:275368 5/28 (18%)
zf-C2H2_8 389..465 CDD:292531 23/110 (21%)
C2H2 Zn finger 417..438 CDD:275368 7/20 (35%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368
C2H2 Zn finger 511..532 CDD:275368
C2H2 Zn finger 541..562 CDD:275368
C2H2 Zn finger 570..590 CDD:275368
C2H2 Zn finger 598..619 CDD:275368
AgaP_AGAP001073XP_003437204.1 BTB 21..116 CDD:279045
BTB 32..116 CDD:197585
zf-C2H2_4 477..500 CDD:290605 7/22 (32%)
C2H2 Zn finger 479..500 CDD:275371 7/20 (35%)
C2H2 Zn finger 509..530 CDD:275371 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.