DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and AgaP_AGAP008515

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_316925.4 Gene:AgaP_AGAP008515 / 1277455 VectorBaseID:AGAP008515 Length:640 Species:Anopheles gambiae


Alignment Length:746 Identity:133/746 - (17%)
Similarity:217/746 - (29%) Gaps:295/746 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CLLC-------MCEYPAMMGDYIDVHSARGDQLEVTTIVNQHFPVQISKESDERICGRCW-KIVS 63
            |.:|       .|.:|....|.:|....|..||.          :||.....:.|||.|: |:.|
Mosquito    11 CRICGMDILDLTCAFPIFGNDRVDQKLERYLQLN----------IQIDDLLPKCICGSCYLKLES 65

  Fly    64 DFHTLHEFVSAAQSSLQETKVALMEDDPLTQETTSFPEIIKLATQEEE----------GVTEPQE 118
                :.:|             |||                  |::.||          |:..|.|
Mosquito    66 ----IDQF-------------ALM------------------ASRTEEAFRAWLGRLRGLNSPAE 95

  Fly   119 LGGR-NFFYPEIKIEEHELDTLPRIEILERSANTQENQDQLEGAARRLRKRLKAEDGSSVDKDKD 182
            .... |...|..:::.                         :|.|..     |....:|..||..
Mosquito    96 AAKNVNVMLPLFRLDP-------------------------DGGADS-----KKGHNASAAKDAR 130

  Fly   183 EDGVEETAEPAPPKKRRGRPRKSDAAVAPPQK---PKEDIQLDL--KAEELDEFV-------DEE 235
            .:.....:...||           |:|:||:|   ...|::|.|  |.:||.:.:       :.:
Mosquito   131 SNPSPTVSTATPP-----------ASVSPPEKGIISYSDLKLGLLIKDQELLKLILKALRWAEND 184

  Fly   236 TDPDFSCLVP--SDNSSEDDGGSDGFDSDSDFE------LDNG-KQEFAVLPKRTVVRPKKYKKR 291
            ....|..|:.  .::|..:...:....:|||..      :..| ...||.:|......|......
Mosquito   185 RRASFEVLIQRLKNSSFREILSNRNLLNDSDLTQLLKSYIGQGVMNSFAAMPPSAASTPLNNNNV 249

  Fly   292 TKPA---EPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRLTHQ- 352
            ..||   :|.:..:..:....:          :.|...|.|.|..|:..:...|..    :|.. 
Mosquito   250 VPPAVMFQPPINPTGGVKSGNQ----------SGFVAPVGPIAGVNVNEYRIDEAS----VTQME 300

  Fly   353 --VDPGYMMCCGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQ----------- 404
              |||...:                     |...:.|.....|:.:| :|..|:           
Mosquito   301 VGVDPDLYL---------------------PYEDEDSSSTNKFEGTR-IEDRQENTVTIKLVTTN 343

  Fly   405 --------VHMDPAV-----KLTFSCDLCSKTFLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFL 456
                    ..|.||:     ...|.|..|.:.|.:...:..|.:.:|:|::. :...:|..|..:
Mosquito   344 VAGDMIENKRMIPAILNVRGTKRFQCSACPECFETNGELQQHIVRRHLPRTN-RTVITEQGKPAI 407

  Fly   457 TERKLKNH------------------------MSSMHDPEST--------IICDKCGKQMRTK-- 487
            ..|..||.                        .|...:|.|.        ::..|..::...|  
Mosquito   408 KIRVRKNKPIAGPLLPPKLIPPSAPVTLTATTPSPTKEPSSAPASPAKGELLVRKSKRKTSLKPE 472

  Fly   488 ---IILKKHQELMHSDK----------------------PRPEPELQQ-----CQICGAWLKGMT 522
               :||:|.|:.....|                      |.|:|:..:     |.:|...|....
Mosquito   473 VSSLILEKQQKKRKVQKGVQKPVQKEAQTPAPPPAPPAPPSPKPKTSRKSNAFCALCRKRLTPKQ 537

  Fly   523 GLKQHMKSIHVESAGEHRCHICAKVSPNARALRRH-IYH-------------------------- 560
            .::.||:..|    ..:.|..|.:...:|..|.|| .||                          
Mosquito   538 TMRVHMQQEH----SRYECEKCDRAFKSALNLSRHQQYHASSSSSSSSTSTVPTELVSSSVSTKR 598

  Fly   561 -------NHECERKFKCTMCEKAFKRPQELK 584
                   ..|.|:..||:.|||||||...||
Mosquito   599 AQKAAQQEEEKEQTHKCSYCEKAFKRSHHLK 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071 18/81 (22%)
FYDLN_acid <191..268 CDD:302856 19/96 (20%)
C2H2 Zn finger 330..351 CDD:275368 3/20 (15%)
C2H2 Zn finger 360..378 CDD:275368 0/17 (0%)
LIM 361..>400 CDD:295319 4/38 (11%)
C2H2 Zn finger 386..406 CDD:275368 5/38 (13%)
zf-C2H2_8 389..465 CDD:292531 19/123 (15%)
C2H2 Zn finger 417..438 CDD:275368 4/20 (20%)
C2H2 Zn finger 448..465 CDD:275368 5/40 (13%)
C2H2 Zn finger 477..498 CDD:275368 6/25 (24%)
C2H2 Zn finger 511..532 CDD:275368 5/20 (25%)
C2H2 Zn finger 541..562 CDD:275368 8/54 (15%)
C2H2 Zn finger 570..590 CDD:275368 10/15 (67%)
C2H2 Zn finger 598..619 CDD:275368
AgaP_AGAP008515XP_316925.4 zf-AD 11..82 CDD:214871 24/115 (21%)
C2H2 Zn finger 369..390 CDD:275368 4/20 (20%)
C2H2 Zn finger 526..547 CDD:275368 5/20 (25%)
zf-C2H2 550..572 CDD:278523 6/21 (29%)
C2H2 Zn finger 552..572 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.