DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG4282 and AgaP_AGAP011548

DIOPT Version :9

Sequence 1:	NP_611118.3	Gene:	CG4282 / 36825	FlyBaseID:	FBgn0034114	Length:	652	Species:	Drosophila melanogaster
Sequence 2:	XP_309960.4	Gene:	AgaP_AGAP011548 / 1271210	VectorBaseID:	AGAP011548	Length:	440	Species:	Anopheles gambiae

Alignment Length:	144	Identity:	46/144 - (31%)
Similarity:	64/144 - (44%)	Gaps:	16/144 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly   491 KKHQELMHSDKPRPEP-ELQ-----------QCQICGAWLKGMTGLKQHMKSIHVESAGEHRCHI 543
            ||.::.....||||:| |:|           .|..|.........|:||:...::|.  ...|.|
Mosquito   293 KKKKKPPKERKPRPKPGEIQVRTALDGSLLFLCPECQMAYPERELLEQHLIGHNLER--RFICDI 355

  Fly   544 CAKVSPNARALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPNCPMTFFCS 608
            |.........|.|| ..:|..||.|.||:|.|||||.::|..|...|:||..:.|..|...|:..
Mosquito   356 CNAALKRKDHLTRH-KQSHNPERPFACTICLKAFKRKEQLTLHFVIHSGEKRHVCQECGKGFYRK 419

  Fly   609 ANMYKHRQRLHRAQ 622
            .::.|| .|.|.|:
Mosquito   420 DHLRKH-TRSHIAR 432

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG4282	NP_611118.3	zf-AD	7..81	CDD:285071
		FYDLN_acid	<191..268	CDD:302856
		C2H2 Zn finger	330..351	CDD:275368
		C2H2 Zn finger	360..378	CDD:275368
		LIM	361..>400	CDD:295319
		C2H2 Zn finger	386..406	CDD:275368
		zf-C2H2_8	389..465	CDD:292531
		C2H2 Zn finger	417..438	CDD:275368
		C2H2 Zn finger	448..465	CDD:275368
		C2H2 Zn finger	477..498	CDD:275368	2/6 (33%)
		C2H2 Zn finger	511..532	CDD:275368	5/20 (25%)
		C2H2 Zn finger	541..562	CDD:275368	6/20 (30%)
		C2H2 Zn finger	570..590	CDD:275368	10/19 (53%)
		C2H2 Zn finger	598..619	CDD:275368	6/20 (30%)
AgaP_AGAP011548	XP_309960.4	C2H2 Zn finger	325..345	CDD:275368	5/19 (26%)
		C2H2 Zn finger	353..373	CDD:275368	6/20 (30%)
		zf-H2C2_2	365..390	CDD:290200	13/25 (52%)
		C2H2 Zn finger	381..401	CDD:275368	10/19 (53%)
		zf-C2H2	407..429	CDD:278523	6/22 (27%)
		C2H2 Zn finger	409..429	CDD:275368	6/20 (30%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910