DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and AgaP_AGAP010926

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_309767.4 Gene:AgaP_AGAP010926 / 1271025 VectorBaseID:AGAP010926 Length:443 Species:Anopheles gambiae


Alignment Length:469 Identity:98/469 - (20%)
Similarity:140/469 - (29%) Gaps:189/469 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 SDAAVAP------PQKPKEDIQLDLKAE--------ELDEFVDEET------------------- 236
            |.||..|      ||:|...:..:|.|.        |.:|.|||:.                   
Mosquito    63 SGAAAFPWPQFLLPQQPITPVSPNLNASSRDYTLTPEKEEIVDEDMPLNLSMKPSTSTPNARHAA 127

  Fly   237 --------DPDFSC---LVPSDNSSEDDGGSDGFDSDSDFELDNGKQEFAVLPKRTVVRPKKYKK 290
                    .|...|   .:..||.|..|..:|. ||..|.::|                      
Mosquito   128 LTHSINIWSPASMCEKETIDGDNQSNIDIENDD-DSSGDLQID---------------------- 169

  Fly   291 RTKPAEPKVRMSRELLEQRKKQQEEYDVIIAKFFTSVLPCAICNLLVHNFTEMQRHHRLTHQVDP 355
                                                           .:|.....||...|...|
Mosquito   170 -----------------------------------------------ESFDSQHHHHHHHHHHQP 187

  Fly   356 GYMMCCGRKFTQR---KVLAEHVLVHWN------------PDHFKCSVCEKSF-----QNSRHLE 400
            ....  .|:..||   ::|.|:..:..|            .|:|..|...|.:     |..::||
Mosquito   188 HQHQ--ERQDRQRETARILTEYNSLLLNGRQSGGGGSRSSQDYFNYSKISKGYFTHLQQQQKNLE 250

  Fly   401 SHQQVHMDPAVKLTFSCDLCSKTFL---------------SKTAID------YHKLNKHVPKSEF 444
            ..:|...|..| |....|..:|..:               ||...|      .|.:.:.:|   |
Mosquito   251 ILRQNRTDLFV-LNGGNDNNNKEGVKNQNQTGHERSGGAGSKQNWDRKLFGISHPVERKIP---F 311

  Fly   445 KFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKIILKKHQELMHSDKPRPEPELQ 509
            ....|...||.         ...:|.      |.:|||..:....|..|. |:||| .||.|   
Mosquito   312 DDHASPPKKKM---------PGRLHQ------CKQCGKTFKRSSTLSTHL-LIHSD-TRPYP--- 356

  Fly   510 QCQICGAWLKGMTGLKQHMKSIHVESAGE--HRCHICAKVSPNARALRRHIYHNHECERKFKCTM 572
             ||.||......:.:|:| ..||   .||  |:|.:|.|....:..|..|: ..|...:.|.|.:
Mosquito   357 -CQYCGKRFHQKSDMKKH-TYIH---TGEKPHKCVVCLKAFSQSSNLITHM-RKHSGYKPFSCGL 415

  Fly   573 CEKAFKRPQELKEH 586
            |:|||:|..:|:.|
Mosquito   416 CDKAFQRKVDLRRH 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856 24/106 (23%)
C2H2 Zn finger 330..351 CDD:275368 3/20 (15%)
C2H2 Zn finger 360..378 CDD:275368 5/20 (25%)
LIM 361..>400 CDD:295319 11/58 (19%)
C2H2 Zn finger 386..406 CDD:275368 6/24 (25%)
zf-C2H2_8 389..465 CDD:292531 19/101 (19%)
C2H2 Zn finger 417..438 CDD:275368 6/41 (15%)
C2H2 Zn finger 448..465 CDD:275368 3/16 (19%)
C2H2 Zn finger 477..498 CDD:275368 7/20 (35%)
C2H2 Zn finger 511..532 CDD:275368 6/20 (30%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 570..590 CDD:275368 8/17 (47%)
C2H2 Zn finger 598..619 CDD:275368
AgaP_AGAP010926XP_309767.4 zf-C2H2 327..349 CDD:278523 8/28 (29%)
C2H2 Zn finger 329..349 CDD:275368 7/20 (35%)
COG5048 337..>413 CDD:227381 27/86 (31%)
zf-H2C2_2 342..366 CDD:290200 13/29 (45%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
zf-H2C2_2 369..394 CDD:290200 10/28 (36%)
C2H2 Zn finger 385..405 CDD:275368 5/20 (25%)
zf-H2C2_2 397..420 CDD:290200 7/23 (30%)
C2H2 Zn finger 413..430 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.