DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4282 and LOC110439432

DIOPT Version :9

Sequence 1:NP_611118.3 Gene:CG4282 / 36825 FlyBaseID:FBgn0034114 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_021331133.1 Gene:LOC110439432 / 110439432 -ID:- Length:360 Species:Danio rerio


Alignment Length:328 Identity:91/328 - (27%)
Similarity:133/328 - (40%) Gaps:35/328 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 EQRKKQQEEYDVII---AKFFTSVL------PCAICNLLVHNFTEMQ--RHHRLTHQVDPGYMMC 360
            |..:.::||:.|.|   ....|:.:      .|..|.....:|....  :.|...|..|..: .|
Zfish    33 ENEESKEEEHQVKIEDETHLQTNGILIRRDENCFSCTQYGKSFASKSKLKIHMNNHTRDKPF-TC 96

  Fly   361 --CGRKFTQRKVLAEHVLVHWNPDHFKCSVCEKSFQNSRHLESHQQVHMDPAVKLTFSCDLCSKT 423
              ||:.|:|...|..|:.:|.....|.|:.|.|||..|.||..|..:|..   :..|:|..|.|:
Zfish    97 TQCGKSFSQSSSLNRHMRIHTGEKPFTCTQCGKSFSQSSHLNQHMMIHTG---EKPFTCSQCGKS 158

  Fly   424 FLSKTAIDYHKLNKHVPKSEFKFTCSECNKKFLTERKLKNHMSSMHDPESTIICDKCGKQMRTKI 488
            |   ..:.|...:..:...|..||||:|.|.:.....|..|: .:|..|....|.:|||......
Zfish   159 F---KRLSYLIEHTRIHTGEKPFTCSQCGKSYYCSSHLIQHI-RIHTGEKPFTCTQCGKSFSRSS 219

  Fly   489 ILKKHQELMHSDKPRPEPELQQCQICGAWLKGMTGLKQHMKSIHVESAGE--HRCHICAKVSPNA 551
            ...:|..:...:||      ..|..|.......|.|.|||: ||   .||  ..|..|.|.....
Zfish   220 SFNQHMRIHTGEKP------FTCTQCRKTFNCSTHLIQHMR-IH---TGEKPFTCTQCGKSFNRL 274

  Fly   552 RALRRHIYHNHECERKFKCTMCEKAFKRPQELKEHTSTHTGEVLYTCPNCPMTFFCSANMYKHRQ 616
            ..|.:|: ..|..::.|.|..|.|:|.:...|..|...||||..:||..|..:...|:|:.|| .
Zfish   275 SHLNQHL-RIHTGQKPFTCIQCGKSFSQSSSLNLHMRIHTGEKPFTCTQCGKSVNRSSNLNKH-M 337

  Fly   617 RLH 619
            ::|
Zfish   338 KIH 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4282NP_611118.3 zf-AD 7..81 CDD:285071
FYDLN_acid <191..268 CDD:302856
C2H2 Zn finger 330..351 CDD:275368 4/22 (18%)
C2H2 Zn finger 360..378 CDD:275368 7/19 (37%)
LIM 361..>400 CDD:295319 15/38 (39%)
C2H2 Zn finger 386..406 CDD:275368 9/19 (47%)
zf-C2H2_8 389..465 CDD:292531 23/75 (31%)
C2H2 Zn finger 417..438 CDD:275368 5/20 (25%)
C2H2 Zn finger 448..465 CDD:275368 5/16 (31%)
C2H2 Zn finger 477..498 CDD:275368 5/20 (25%)
C2H2 Zn finger 511..532 CDD:275368 7/20 (35%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 570..590 CDD:275368 6/19 (32%)
C2H2 Zn finger 598..619 CDD:275368 6/20 (30%)
LOC110439432XP_021331133.1 COG5048 <61..247 CDD:227381 51/199 (26%)
C2H2 Zn finger 68..88 CDD:275368 3/19 (16%)
C2H2 Zn finger 96..116 CDD:275368 7/19 (37%)
C2H2 Zn finger 124..144 CDD:275368 9/19 (47%)
C2H2 Zn finger 152..172 CDD:275368 5/22 (23%)
C2H2 Zn finger 180..200 CDD:275368 6/20 (30%)
C2H2 Zn finger 208..228 CDD:275368 5/19 (26%)
C2H2 Zn finger 236..256 CDD:275368 7/20 (35%)
zf-H2C2_2 248..273 CDD:316026 11/28 (39%)
C2H2 Zn finger 264..284 CDD:275368 5/20 (25%)
zf-H2C2_2 276..301 CDD:316026 8/25 (32%)
C2H2 Zn finger 292..312 CDD:275368 6/19 (32%)
zf-H2C2_2 304..329 CDD:316026 9/24 (38%)
C2H2 Zn finger 320..340 CDD:275368 6/20 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.